Property Summary

NCBI Gene PubMed Count 675
PubMed Score 4494.40
PubTator Score 4119.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer 1.188 0.000
lung cancer 1.600 0.000
lung adenocarcinoma 1.042 0.000
Breast cancer 1.100 0.000
invasive ductal carcinoma 1.200 0.000
ovarian cancer 1.100 0.002

Synonym

Accession P09874 B1ANJ4 Q8IUZ9 PARP-1
Symbols PARP
PPOL
ADPRT
ARTD1
ADPRT1
PARP-1
ADPRT 1
pADPRT-1

Gene

PDB

4XHU   1UK0   1UK1   1WOK   2COK   2CR9   2CS2   2DMJ   2JVN   2L30   2L31   2N8A   2RCW   2RD6   2RIQ   3GJW   3GN7   3L3L   3L3M   3OD8   3ODA   3ODC   3ODE   4AV1   4DQY   4GV7   4HHY   4HHZ   4L6S   4OPX   4OQA   4OQB   4PJT   4R5W   4R6E   4RV6   4UND   4UXB   4ZZZ   5A00   5DS3   5HA9  

  Ortholog (13)

 GWAS Trait (1)

Gene RIF (624)

PMID Text
27256882 PARP-1 ADP-ribosylates and inhibits negative elongation factor (NELF), a protein complex that regulates promoter-proximal pausing by RNA polymerase II.
27055253 Activation of the PI3K/mTOR Pathway following PARP Inhibition in Small Cell Lung Cancer.
26975633 Our combination strategy could expand the clinical application of PARP-inhibitors to non-BRCA mutated cancers and may target a new group of NSCLC patients who show limited response to current therapies.
26920250 Data suggest that inhibition of PARP1 (preferential inhibition of PARP1 over PARP2) arrests cell cycle/cell proliferation and promotes apoptosis of breast tumor cells (including triple negative breast tumor cells).
26895424 Results indicate a PARP1-dependent mechanism that regulates non-homologous end-joining through localized chromatin expansion and deposition of the histone variant H3.3 by CHD2 at DNA breaks promoting DNA repair.
26826460 we investigated the association of radiotherapy related acute side effects, with X-ray repair cross complementing group 1 (XRCC1) and Poly (ADP-ribose) polymerase 1 (PARP1) DNA repair gene expression level in breast cancer patients
26822515 It was concluded that PARP-1 was involved in the DNA damage repair induced by HQ via increasing the accumulation of apoptosis antagonizing transcription factor through PARylation.
26730949 Data show that interaction of cyclin-dependent kinase inhibitor 1A (p21 Cip1) with poly(ADP-ribose) polymerase-1 (PARP-1) is mediated by poly(ADP-ribose) (PAR).
26673720 The initial affinity between the PARP1, PARP2 and the DNA damaged site appears to influence both the size of the Poly(ADP-Ribose) synthesized and the time of residence of PARylated PARP1 and PARP2 on DNA damages.
26634655 Suggest role for LRP1/PARP1 signaling in endothelial cell proliferation and retinal neovascularization induced by hypoxia.
More...

AA Sequence

MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVE      1 - 70
VDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLS     71 - 140
KKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKG    141 - 210
DEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAIL    211 - 280
DRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKV    281 - 350
KKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT    351 - 420
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPV    421 - 490
EVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLV    491 - 560
DIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKN    561 - 630
FTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK    631 - 700
LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLD    701 - 770
IEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE    771 - 840
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHT    841 - 910
SQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVN    911 - 980
DTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW                                        981 - 1014
//

Text Mined References (694)

PMID Year Title
27257257 2016 ADP-ribose-derived nuclear ATP synthesis by NUDIX5 is required for chromatin remodeling.
27256882 2016 Chemical genetic discovery of PARP targets reveals a role for PARP-1 in transcription elongation.
27067600 2016 HPF1/C4orf27 Is a PARP-1-Interacting Protein that Regulates PARP-1 ADP-Ribosylation Activity.
27055253 2016 Activation of the PI3K/mTOR Pathway following PARP Inhibition in Small Cell Lung Cancer.
26975633 2016 APR-246 (PRIMA-1(MET)) strongly synergizes with AZD2281 (olaparib) induced PARP inhibition to induce apoptosis in non-small cell lung cancer cell lines.
26920250 2016 Poly (ADP-ribose) polymerases inhibitor, Zj6413, as a potential therapeutic agent against breast cancer.
26895424 2016 PARP1 Links CHD2-Mediated Chromatin Expansion and H3.3 Deposition to DNA Repair by Non-homologous End-Joining.
26826460 2016 Decreased DNA repair gene XRCC1 expression is associated with radiotherapy-induced acute side effects in breast cancer patients.
26822515 2016 Poly(ADP-ribosyl)ation of Apoptosis Antagonizing Transcription Factor Involved in Hydroquinone-Induced DNA Damage Response.
26730949 2016 p21CDKN1A Regulates the Binding of Poly(ADP-Ribose) Polymerase-1 to DNA Repair Intermediates.
More...