Property Summary

NCBI Gene PubMed Count 675
PubMed Score 4494.40
PubTator Score 4119.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 1.3e-06
medulloblastoma, large-cell 1.100 6.2e-05
non-small cell lung cancer 1.188 7.8e-24
lung cancer 1.600 3.8e-04
lung adenocarcinoma 1.042 6.0e-08
Breast cancer 1.100 3.3e-16
invasive ductal carcinoma 1.200 1.5e-04
ovarian cancer 1.100 2.2e-03

 GWAS Trait (1)

Gene RIF (624)

PMID Text
27256882 PARP-1 ADP-ribosylates and inhibits negative elongation factor (NELF), a protein complex that regulates promoter-proximal pausing by RNA polymerase II.
27055253 Activation of the PI3K/mTOR Pathway following PARP Inhibition in Small Cell Lung Cancer.
26975633 Our combination strategy could expand the clinical application of PARP-inhibitors to non-BRCA mutated cancers and may target a new group of NSCLC patients who show limited response to current therapies.
26920250 Data suggest that inhibition of PARP1 (preferential inhibition of PARP1 over PARP2) arrests cell cycle/cell proliferation and promotes apoptosis of breast tumor cells (including triple negative breast tumor cells).
26895424 Results indicate a PARP1-dependent mechanism that regulates non-homologous end-joining through localized chromatin expansion and deposition of the histone variant H3.3 by CHD2 at DNA breaks promoting DNA repair.
26826460 we investigated the association of radiotherapy related acute side effects, with X-ray repair cross complementing group 1 (XRCC1) and Poly (ADP-ribose) polymerase 1 (PARP1) DNA repair gene expression level in breast cancer patients
26822515 It was concluded that PARP-1 was involved in the DNA damage repair induced by HQ via increasing the accumulation of apoptosis antagonizing transcription factor through PARylation.
26730949 Data show that interaction of cyclin-dependent kinase inhibitor 1A (p21 Cip1) with poly(ADP-ribose) polymerase-1 (PARP-1) is mediated by poly(ADP-ribose) (PAR).
26673720 The initial affinity between the PARP1, PARP2 and the DNA damaged site appears to influence both the size of the Poly(ADP-Ribose) synthesized and the time of residence of PARylated PARP1 and PARP2 on DNA damages.
26634655 Suggest role for LRP1/PARP1 signaling in endothelial cell proliferation and retinal neovascularization induced by hypoxia.
26626480 Results show how PARP-1 DNA damage detection leads to local unfolding of the helical domain relieving its autoinhibition and blocking productive NAD+ binding.
26626479 Results show the molecular mechanism by which PARP-1 senses DNA single-strand breaks (SSBs) and becomes allosterically activated. It is through the recognition by two N-terminal zinc fingers then C-terminal catalytic domain controlling PARP-1 activity.
26619102 overexpression of PARP-1 in poor early treatment responders suggests that it may contribute to treatment failure in this group of children with acute lymphoblastic leukemia
26603896 suggested that DNA-PK and PARP-dependent recruitment of XRCC1 is necessary to effectively protect, repair, and restart stalled replication forks, providing new insight into how genomic stability is preserved
26540566 Data indicate that the expression of PARP1 and FOXO3A play pivotal roles in gastric cancer progression.
26522181 DNA damage induced necrosis through a PARP1-dependent and p53-independent pathway.
26513298 Data show that E7449 represents a dual Poly(ADP-ribose) Polymerase 1/2 and tankyrase 1/2 inhibitor which has the advantage of targeting Wnt/beta-catenin signaling addicted tumors.
26505995 we show that PARP inhibitor sensitivity in Ewing's sarcoma cells is not through an apparent defect in DNA repair by homologous recombination , but through hypersensitivity to trapped PARP1-DNA complexes
26429911 PARP-1 negatively regulates the suppressive function of Treg cells at the posttranslational level via FOXP3 poly(ADP-ribosyl)ation.
26424850 results reveal that careful titration of laser irradiation conditions allows induction of varying amounts and complexities of DNA damage that are gauged by differential PARP activation regulating protein assembly at the damage site
26391948 PARylation is involved in the recruitment of RECQL5 and WRN to laser-induced DNA damage and RECQL5 and WRN have differential responses to PARylated PARP1 and Poly(ADP-ribose).
26387143 Non-small cell lung cancer patients with high intra-tumoral PARP1 activity had a poor prognosis.
26379653 HIV-1 replication is enhanced by PARP1 in monocyte derived macrophages
26370511 Chromatin immunoprecipitation confirmed that PARP1 inhibition led to H3K27me3 deposition at EZH2 target genes, which resulted in gene silencing.
26356822 Small molecule inhibition of CHFR-PARP1 interaction is a novel potential therapeutic approach to increase the efficacy of taxane-based chemotherapy in cancer.
26351319 Data indicate that poly(ADP-ribose) polymerase 1 (PARP1) protein is expressed in pediatric high-grade astrocytomas (pHGA) and diffuse intrinsic pontine gliomas (DIPG) patient samples and cell lines.
26344098 Data reports the crystal structure of Timeless-PARP-1 complex and provides evidence that Timeless is recruited to sites of DNA damage through PARP-1 to mediate homologous recombination repair of DNA double-strand breaks.
26321255 PARP1- and CTCF-regulate contacts between circadian loci and the repressive chromatin environment at the lamina therefore mediate circadian transcriptional plasticity.
26314963 PARP-1 has an important role in the progression of acute myeloid leukemia by suppressing the myeloproliferative leukemia virus oncogene
26305327 Our results suggest that PARP1 controls the fidelity of gene transcription and marks actively transcribed gene regions by selectively binding to transcriptionally active chromatin.
26261599 PARP1 over-expression in nucleus and cytoplasm is a feature of triple negative breast tumors.
26205779 PARP-1 is activated in human asthma and that its inhibition is effective in blocking established asthma in mice.
26183824 PARP regulates estradiol-mediated cell growth by controlling the ER/IGF-1R/PDZK1 axis.
26181362 The data obtained suggest that PARP1 and TDP1 bind in an antiparallel orientation; the N-terminus of the former protein interacts with the C-terminal domain of the latter.
26181065 stimulation of PARP-1 activity in CDA-deficient cells restores replication and, thus, chromosome segregation. Moreover, increasing intracellular dCTP levels generates under-replication-induced sister-chromatid bridges as efficiently as PARP-1 knockdown
26170451 Data show that nucleotide excision repair factor XPC-RAD23B is a target of poly(ADP-ribosyl)ation catalyzed by poly(ADP-ribose) polymerase 1 (PARP1).
26157130 The viral processivity factor of KSHV (PF-8) directly interacted with PARP-1 and was sufficient and necessary to degrade PARP-1 protein in a proteasome-dependent manner.
26136340 Noncovalent binding of ADP-ribose polymers with TET1 catalytic domain decreases TET1 hydroxylase activity while the covalent PARylation stimulates TET1 enzyme. In addition, TET1 activates PARP-1/ARTD1 independently of DNA breaks.
26091342 Studies indicate that poly (ADP-ribose) glycohydrolase (PARG) and terminal ADP-ribose glycohydrolase 1 (TARG1) are key enzymes in poly(ADP-ribose) polymerases (PARPs)-mediated ADP-ribosylation.
26091341 Studies indicate that poly(ADP-ribose) polymerase 1 (PARP1) inhibitors were recently shown to have potential clinical impact in a number of disease settings, particularly as related to cancer therapy.
26091339 Studies indicate that the diversity of biological processes now known to require poly(ADP-ribosyl) transferases (PARPs) and ADP-ribosylation was tremendously expanded.
26090615 Data show that YM155 did not trigger apoptosis, but induced parthanatos, a cell death dependent on poly(ADP-ribose) polymerase 1 (PARP-1) hyper-activation.
25998844 The results of this study suggested that the PARP-1 gene polymorphisms may play an important role in the etiology of Alzheimer's Disease.
25992604 To be poly(ADP-ribose)polymerase-1 (PARP-1) bound to the EPHX1 proximal promoter.
25981734 They also imply that therapeutic applicability of PARP-1 inhibitors is not limited to BRCA mutation carriers but can be extended to patients harboring deficiencies in other components of the pathway(s).
25943894 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
25940138 these findings suggest that ACBD3 has prominent impacts on cellular NAD(+) metabolism via regulating PARP1 activation-dependent auto-modification and thus cell metabolism and function.
25938539 Results indicate that poly(ADP-ribose) polymerase-1 (PARP-1) controlled transcription factor Snail expression at transcriptional level in cells exposed to doxorubicin.
25916114 Studies of the molecular mechanisms of regulation of transcription factor PARP1 can serve as a basis for search and design of new inhibitors
25883215 Silencing of CBLC causes increased sensitivity to PARP1 inhibitor olaparib in breast cancer cell line models and that defective homologous recombination (HR) DNA repair is the likely cause.
25882840 The N terminus of nuclear GAPDH binds with PARP-1, and this complex promotes PARP-1 overactivation both in vitro and in vivo.
25881554 Under oxidative stress conditions PARP-1 activity increases, leading to an accumulation of ADP-ribose polymers and NAD(+) depletion, that induces energy crisis and finally cell death
25865228 Report autoimmune response to PARP1 in tumors.
25837821 Single nucleotide polymorphisms in PARP1 gene is associated with multiple primary melanoma.
25833211 Report shows that HER2 positive breast cancers exhibit increased expression of PARP1 and phospho-p65.
25828893 In the context of tyrosine kinase-activated leukemias, c-MYC contributes to aberrant DNA repair through downstream targets LIG3 and PARP1 up-regulation.
25818652 In the presence Streptococcus pyogenes NAD(+) glycohydrolase (SPN), host cell ATP is depleted and the pro-inflammatory mediator high-mobility group box-1 (HMGB1) protein is released from the nucleus by a PARP-1-dependent mechanism.
25808111 study provides evidence that MAR-binding proteins are involved in the development and progression of PCa. PARP-1 could play a key role in the compartmentalization of chromatin and in the development of the more aggressive phenotype.
25800440 PARP1 interdomain linker regions that connect BRCT to WGR module and WGR to PRD domain undergo prominent ADP-ribosylation during PARP-1 automodification. ADP-ribosylation occurs also D-loop structure within PARP1 catalytic fold in three zinc fingers.
25793984 Low shear stress can induce inflammatory response via PECAM-1/PARP-1/HMGB1 pathway.
25779917 Data indicate that transfected poly (ADP-ribose) polymerase 1 (PARP-1) gene affects growth and UV-induced homologous recombination in Saccharomyces cerevisiae.
25749521 TNKS1BP1 has a role in DNA double-strand break repair though DNA-PKcs autophosphorylation which is dependent on PARP-1
25738796 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways
25733866 Mutant p53 depletion profoundly influenced PARP1 localization and increased the level of PCNA and MCM4 proteins.
25722289 SUMOylation and PARylation cooperate to recruit and stabilize SLX4 at DNA damage sites.
25634215 our findings reveal a new mechanism of platinum sensitivity in EOC that, unlike defective HR, may lead to a discordance in sensitivity to platinum and PARPi
25611238 PARP-1 immunohistochemical expression is a marker of good prognosis and is predictive of response to NCT in locally advanced breast cancer
25555679 we summarize the status quo of this molecular cooperation and discuss open questions that provide a basis for future studies to dissect the cooperative functions of RecQL helicases and PARP1 in aging and carcinogenesis--{REVIEW}
25536389 These data suggest that NAD depletion by PARP1 activation is essential for the modulation of insulin sensitivity in oleic acid-induced lipotoxicity.
25528020 our results demonstrate the biological role of both forms of PARP1 (cleaved and non-cleaved) in DNA repair in breast cancer based on the significant association with other key DNA damage repair proteins.
25526641 Results showed strong positive correlation between PARP1 and OGG1 in patients with colon cancer where both mRNA and protein levels were increased suggesting reciprocal influence on their expression and stability that may contribute to disease progression.
25517228 PARP1-sirtuin 1 functional interplay regulates LPS-mediated HMGB1 secretion
25483710 while PARP1 over-expression was detected in blasts not responsive to olaparib, phosphorylation of the histone H2AFX (gammaH2AX) was associated with drug sensitivity.
25480692 Higher PARP1 expression in invasive breast cancer correlated with increased in vitro chemosensitivity against docetaxel and epirubicin and tumors with high PARP1 expression were more sensitive to anthracycline/taxane based chemotherapy.
25400754 PARP1 expression was independently related to longer progression-free survival in limited-stage small cell lung cancer.
25352594 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
25337234 Adriamycin can increase PARP-1 activation in a dose- and time-dependent manner in MCF-7 cells.
25333575 Knockdown of GRP78 enhances the PARP cleavage in human pancreatic cancer cells.
25331333 Results show an inverse association that SNPs in PARP1, T allele of rs3219090 is associated with reduced risk of melanoma and is also associated with poor survival.
25306110 MacroH2A1.1 and PARP-1 cooperate to regulate transcription by promoting CBP-mediated H2B acetylation.
25278026 Data suggest that the 3'-5' DNA exonuclease TREX1 may contribute to stabilization of poly(ADP-ribose) polymerase-1 (PARP1) levels in the DNA damage response and its activity.
25257171 Basal PARP1 activity was sufficient to modify E2F1 by poly(ADP-ribosyl)ation, which stabilized the interaction between E2F1 and the BIN1 tumor suppressor in the nucleus
25225750 The study found that PARP-1 rs3219073 C>G polymorphism is indeed associated with lung cancer susceptibility. The carriers of G alleles may have reduced risk of lung cancer, especially adenocarcinoma.
25220464 ARTD1-mediated PAR synthesis, but not direct NAD(+) depletion, resulted in a block to glycolysis and ATP loss.
25161998 Our findings constitute an important step in the field, especially in the era of PARP1 inhibitors, and may serve as a base for future clinical trials with these agents in CLL.
25136112 Unanticipated nucleosome assembly activity of automodifies-PARP-1, coupled with the fast turnover of the modification, suggests a model in which DNA damage or transcription events trigger transient histone chaperone activity.
25133494 Nuclear Smad function is negatively regulated by PARP-1 that is assisted by PARP-2 and positively regulated by PARG during the course of TGFB signaling.
25128455 Results show that poly (ADP-ribose) polymerase (PARP) inhibition has antitumour effects and increases trastuzumab activity in oncogene protein HER2 overexpressing breast cancer.
25118896 Our data indicate that both PARP1 and p53 activation is a feature in meningiomas of higher grade
25106941 The polymorphism of SNP rs1136410 in PARP1 gene may modify the susceptibility to male infertility with oligospermia.
25103497 TGFbeta can induce "BRCAness" in certain breast cancers carrying wild-type BRCA genes and enhance the responsiveness to PARP inhibition.
25052090 Inhibition of RIP1, AIF, Bax and the MPT pore failed to abrogate MNNG- and beta-Lapachone-induced necrosis. Although JNK and calpain both contribute to PARP1-induced necrosis, they do so via parallel mechanisms.
25037599 PARP-1 gene is up-regulated in LNCaP and PC-3 prostate cancer cell lines.
24970803 PARP-1 PARP-1 PARP-1
24956560 G allele carriers of PARP-1 G1672A polymorphism are at risk of having Graves disease.
24953096 XPA and PARP1 regulate each other in a reciprocal and poly(ADP-ribose)-dependent manner.
24939750 mediates epigenetic control of TET1 tumor suppressor activity in cancer cell lines
24889936 the expression pattern of Parp-1 in normal and cancer tissue and the in vivo functional effects of Parp-1 depletion point to a novel role for this protein in pancreatic carcinogenesis
24886575 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
24874429 PARP1 is upregulated in TSC2 deficient cells in an mTOR sensitive manner.
24870775 Two novel alterations in exon 21 of PARP1 were found to be associated with increased risk of colorectal cancer in a Saudi population. The variants were Lys933Asn and Lys945Asn.
24866151 We identified differential therapeutic vulnerabilities that emerge upon the loss of both PTEN and p53, and observed that combined inhibition of PARP and PI3K provides increased efficacy in hormone-insensitive advanced prostate cancer.
24856976 high expression of the PARP-1 protein among patients with B-lymphoblastic leukemia/lymphoma is related to a complex karyotype and Bcl-2 positivity.
24853559 present meta-analysis provides evidence that the PARP-1 Val762Ala may be involved in cancer development at least in some ethnic groups
24847116 new mechanism-based therapeutic approaches for PCa by targeting PARP and the DDR pathway involving c-Myb, TopBP1, ataxia telangiectasia mutated- and Rad3-related (ATR), and Chk1.
24843141 This study demonstrates a critical role of PARP1 in mediating smooth muscle cell loss in patients with progeria and elucidates a molecular pathway underlying the progressive SMC loss in progeria.
24832602 beta-lapachone induces programmed necrosis through the NQO1-dependent ROS-mediated RIP1-PARP1-AIF pathway.
24829399 PARP-1 played a fundamental role in hyperstretch-induced inflammation. PARP-1 silencing could be used as a potential therapeutic approach to reverse bronchial epithelial inflammation in asthma
24821649 Report synergistic cytotoxicity of PARP1 inhibitor ABT-888 and temozolomide in dual-drug targeted magnetic nanoparticles.
24761869 High PARP1 expression is associated with non-small cell lung cancer.
24726141 a novel mechanism of PARP1 in human cancer through its methylation by SMYD2
24684389 review describes the multistep course of parthanatos and its dependence on PARP1 signalling and nuclear AIF translocation.
24636898 A complex comprising p300/c-Jun/PARP-1 that bound wild type.
24595077 Despite the limitations, hnRPUL1 and PARP1 were downregulated in renal cell carcinoma and connected with the prognosis.
24588584 Structural information was characterized for DNA-induced conformational activation of full-length PARP-1.
24556618 Rucaparib accumulates and is retained in tumour cells and inhibits PARP for long periods such that weekly schedules have equivalent anticancer activity
24550317 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
24535833 Higher levels of PARP1 gene expression in tumors were shown to be associated with tumor ulceration in melanoma.
24535158 The presence of PARP-1 nuclear-cytoplasmic expression may be a new potential unfavorable prognostic factor in lymph node- negative early breast cancer
24489833 This meta-analysis found evidence for an association between the PAPR1 Val762Ala and cancer susceptibility.
24488929 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
24448423 Findings imply that the genetic (BRCA1 mutation) and epigenetic mechanisms (such as hypomethylated ETS1 motif, and histone modification H3K9ac and ETS1 binding) are jointly involved in the malignant progression of PARP1-related ovarian cancer.
24436031 PARP-1 expression is higher in prostate cancer than benign prostatic hyperplasia which may implicate that PARP-1 is involved in the development of prostate cancer.
24418364 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
24392019 Val762Ala variant has functional effect and structural impact on the PARP1
24378347 CDK1 inhibition represents a plausible strategy for expanding the utility of PARP inhibitors to BRCAproficient breast cancers
24356817 These data suggest that PARP is a potential target for tumors harboring inactivating mutations in STAG2, and strongly recommend that STAG2 status be determined and correlated with therapeutic response to PARP inhibitors
24356582 PAR, supplied by PARP1, interacts with Chk1 via a novel PAR-binding regulatory (PbR) motif in Chk1, independent of ATR and its activity
24319532 Chronic PARP-1 inhibition appears to be beneficial in conditions of chronic oxidative stress.
24275069 We found that arsenite binding as well as zinc loss altered the conformation of zinc finger structure which functionally leads to PARP-1 inhibition.
24270264 These results show for the first time that the DNA damage/PARP-1 signaling pathway is important for pulmonary arterial hypertension development.
24239883 these data revealed that inhibition of PARP1 by small interfering RNA (siRNA) could enhance docetaxel's activity against PC3 cells, which is associated with an accelerate repression of EGF/Akt/FOXO1 signaling pathway.
24219164 PARP1 inhibitor, AZD2281, induced growth retardation of the DSB repair-impaired TE-6 cells.
24203816 meta-analysis suggests that the PARP-1 rs1136410: T > C polymorphism is a susceptibility factor for gastrointestinal cancers [review]
24197988 The hypermethylation of PARP-1 in serum correlated with a shorter progression-free survival time.
24191908 BRCA1 promoter hypermethylation, 53BP1 protein expression and PARP-1 activity as biomarkers of DNA repair deficit in breast cancer.
24180296 results raise the possibility that the promoter (-1672) polymorphism of the PARP-1 gene may be a risk factor for AR
24145797 PARP1 is required for remodelling of the FOS promoter-proximal nucleosome, and orchestrates the exchange of the histone variant H2A.Z with H2A.
24140708 PARP-1 serves as a transcriptional coactivator, upregulating the transcriptional activity of Nrf2 by enhancing the interaction among Nrf2, MafG, and the the antioxidant response element.
24088713 Results reveal a novel mechanism for the regulation of cellular ARTD1 activity by SET7/9 to assure efficient PAR formation upon cellular stress.
24085845 Stabilization of mutant BRCA1 protein confers PARP inhibitor and platinum resistance.
24079274 ). These compounds also reduced HO-induced synthesis of poly(ADP-ribose) in cultured human ovarian carcinoma (SKOV-3) cells in a dose-dependent manner.
24055346 Data indicate that scaffold attachment factor SAFB1 is transiently recruited to DNA breaks in a poly(ADP-ribose)-polymerase 1- and poly(ADP-ribose)-dependent manner.
24043304 These results identified poly(ADP-ribosyl)ation of farnesoid X receptor by PARP1 as a key step in oxidative-stress-induced hepatic cell death.
24038028 Using gene reporter assays, we show that promoter variations in 11 intrinsic apoptosis genes, including ADPRT, APAF1, BCL2, BAD, BID, MCL1, BIRC4, BCL2L1, ENDOG, YWHAB, and YWHAQ, influence promoter activity in an allele-specific manner.
24013388 M. fermentans modifies the cellular Topo I activity by activation of PARP-I via the induction of the MAPK signal transduction pathway.
23974709 Inhibition of PARP1 through gene deletion reverses behavioral deficits and protects against dopaminergic neuronal loss.
23940283 PARP-1 regulates expression of transforming growth factor-beta (TGF-beta) receptors and TGF-beta signaling in T cells
23939864 Data show that the interaction between Artd1 and Sox2 is crucial for the first steps of the reprogramming process and that early expression of Fgf4 is an essential component for the successful generation of iPSCs.
23926104 TRIM33 plays a role in PARP-dependent DNA damage response and regulates ALC1 activity by promoting its timely removal from sites of DNA damage.
23923393 Report design/structure of novel PARP-1 inhibitors.
23913164 findings have shown that Tdp1 and PARP-1 are highly expressed in rhabdomyosarcoma tumors and knockdown of TDP1 and inhibition of PARP-1 sensitized rhabdomyosarcoma cells to camptothecin treatment
23910651 These data demonstrate that natural polymorphisms in the host affecting proteins such as PARP1 can have a significant effect on hepatitis B virus replication.
23883585 PARP1 hyperactivation and NQO1 expression were major determinants of beta-lapachone-induced lethality.
23871147 PARP-1's alternative modes of DNA recognition serve as a means to differentiate between distinct aspects of the enzyme's function.
23833192 These results identify FUS as a new factor in the immediate response to DSBs that functions downstream of PAR polymerase to preserve genomic integrity.
23807292 PARP-1-positive cells resulted significantly higher in patients with prostate carcinoma compared with controls
23803078 PARP1 rs1805414 SNP polymorphisms are associated with breast cancer.
23785295 These results suggest that inhibition of PARP interferes with key metastasis-promoting processes, leading to suppression of invasion and colonization of distal organs by aggressive metastatic cells.
23775790 DNA damage-induced inhibition of rRNA synthesis is dependent on the activities of both DNA-PK and PARP-1.
23762867 Abnormal hypomethylation of CpG sites within the ETS motif in the core promoter region may be responsible for PARP1 overexpression in endometrial adenocarcinoma tissues.
23760440 findings suggest that the poly(ADP-ribose) polymerase-1 Val762Ala polymorphism is associated with a decreased risk of advanced pelvic organ prolapse
23760205 Inhibition of the PARP pathway does not protect against TNF-induced necroptosis, the PARP-1 inhibitor 3-AB prevented MNNG- but not TNF-induced adenosine-5'-triposphate depletion, translocation of apoptosis-inducing factor, and necrosis.
23757351 We identified PARP1 as a direct target of miR-223, and showed that miR-223 upregulation results in increased sensitivity to chemotherapy by downregulating PARP1, providing a potential therapeutic vulnerability node for exploitation in the clinic
23644255 Variants in ESR1 and PARP1 modify effect of passive smoking on breast cancer risk.
23640560 Our findings show that the PARP inhibitor 3-AB can downregulate the expression of PARP-1 at transcriptional and translational levels in C13 FNx01 cells.
23633189 Our studies suggest that the PARP-1 Val762Ala polymorphism may be a genetic risk factor for cervical cancer.
23616419 PARP1 (89 kDa) in lymphocytes isolated from newborn babies of diabetic women with unbalanced glycaemic control.
23608917 Genetic variation within PARP1 and CARD10 was associated with rate of hippocampal neurodegeneration in APOE e3/e3 patients.
23593027 our data suggest a novel type of gene regulation: a coordinated transcription or silencing of gene clusters delimited by DSB hot spots as well as PARP1 and HNRNPa2B1 binding sites.
23577092 hnRPUL1 as a new component related to PARP1 in DNA damage response and repair
23576132 Variants in the PARP1 gene might play a role in susceptibility to TS.
23574784 PARP1 may have an independent role in response to chemotherapy separate from BRCA gene mutation and partly due to reduced PARP cleavage
23568489 These data define PARP1 as a critical mediator of chromosomal translocations and raise the possibility that oncogenic translocations occurring after high-dose therapy could be prevented by treatment with a clinically available PARP1 inhibitor.
23563481 PARP-1 regulates ionizing radiation-induced autophagy in nasopharyngeal carcinoma cells.
23554447 PARP hyperactivation is associated with cisplatin resistance in non-small cell lung carcinoma.
23548269 Data indicate that interruption of ATR signaling strikingly further sensitized BRCA1- and BRCA2-deficient ovarian cancer cells to PARP inhibition.
23537197 We confirm the protective role in malignant melanoma of the rs3219090 located on the PARP1 gene
23510475 Apoptosis in breast cancer cells is induced by PARP cleavage following vitamin E treatment.
23486608 In this pilot study, we showed for the first time, that PARP is overexpressed in testicular germ cell tumours compared to normal testis.
23479135 XRCC1 Arg399Gln, PARP1 Va1762Ala and APE1 Asp148Glu SNPs in the base excision repair pathway may influence the prognosis of advanced non-small cell lung cancer patients following platinum-based chemotherapy
23467693 The amount of poly(ADP-ribose) in a cell is regulated under the control of PARP1/PARG gene expression balance.
23455322 HIF-2alpha mRNA expression, protein levels and HIF-2-dependent gene expression are regulated by PARP-1.
23438649 the identification of PARP-1 autopoly(ADP-ribosyl)ation sites
23430444 Susceptibility to colorectal cancer is linked to PARP1 (Ala62Val) polymorphism in a northeast Chinese population.
23429506 PRX2 battles poly(ADP-ribose) polymerase 1- and p53-dependent prodeath pathways after ischemic injury
23410825 our data confirm that platinum DNA adduct accumulation is linked to chemosensitivity, which increase by pharmacological PARP inhibitors points to a role of PARP-dependent DNA repair in the process
23355608 XRCC1 is recruited to single-strand break repair by PARP-1, responsible for the initial recognition of the break.
23319653 Data indicate that poly(ADP-ribose) polymerase-1 (PARP-1)collaborates with DNA-binding protein 2 (DDB2) to increase the efficiency of the lesion recognition step of global genomic subpathway of NER (GG-NER).
23317230 ADPRT Arg194Trp polymorphism was not associated with noncardia gastric cancer.
23301673 PARP1 overexpression is associated with pleural mesothelioma.
23275151 Collectively, these data suggest that there is a synergistic relationship between PARP inhibition and low ERCC1 expression in NSCLC that could be exploited for novel therapeutic approaches in lung cancer therapy based on tumor ERCC1 expression.
23255787 data indicate a novel role of PARP-1 in the transcriptional repression of integrated retroviruses
23254695 Therefore, strategies that target PAR metabolism for the improved treatment of cancer may be required to target PARP-1 and PARG individually in order to optimize cancer cell death.
23244082 ADPRT polymorphisms might be associated with outcomes of breast cancer.
23229555 These results suggest a cooperative activity between CAD and DNAS1L3 to accomplish internucleosomal DNA fragmentation .
23229313 PARP suppresses transcription-mediated 53BP1 foci formation, but that this does not occur through the BER pathway
23219533 Poly-ADP-ribosylation of poly(A)polymerase can control processing of mRNA precursors: PARP1 is a regulator of polyadenylation during thermal stress.
23132853 the model that PAR present on PARylated PARP1 acts as an allosteric effector of ALC1 nucleosome remodeling activity.
23110147 Data indicate that the massive poly(ADP-ribose) (PAR) synthesis following PARP-1 activation leads to the modulation of mTORC1 pathway.
23104860 binds to the C-terminal-100 amino acids of NEIL1
23085506 PARP-1 played a fundamental role in low shear stress induced inflammation.
23073772 The results show strong evidence that the variant (C) allele of PARP1 confers significant increased risk for cancer in the Chinese.
23049934 Knocking down human PARP-1 decreases both the amount of amastigotes and trypomastigotes in cell culture, indicating that the effect would be mainly due to inhibition of human PARP-1.
23045548 data support a model in which poly(ADP-ribosyl)ation of DDB2 suppresses DDB2 ubiquitylation and outline a molecular mechanism for PARP1-mediated regulation of nucleotide excision repair through DDB2 stabilization and recruitment of the chromatin remodeler ALC1
23040216 Observations indicate a significant relationship between p22phox C242T and PARP-1 Val762Ala polymorphisms, CAD and its severity, but not with occurrence of MI in T2DM individuals with significant coronary stenoses.
23038248 PARP activation following UVR exposure promotes association between PARP-1 and XPA
23031826 The histone variant macroH2A1.1 is recruited to DNA double-strand breaks through a mechanism involving PARP1.
23027378 study demonstrated that LPS increased ICAM-1 and iNOS expression via TLR4/PARP1/NF-kappaB pathway. PARP1 might be an indispensable factor in TLR4-mediated inflammation after LPS stimulation.
23020228 The protein expression levels of poly (ADP-ribose) polymerase (PARP) and Bcl-2 were downregulated notably by extract from cochinchina momordica seed treatmen in SGC7901 cells.
22993403 Atudies identify novel functions of PARP-1 in promoting disease progression, and ultimately suggest that the dual functions of PARP-1 can be targeted in human prostate cancer to suppress tumor growth and progression to castration resistance.
22983827 No association between ADPRT Val762Ala polymorphism and the risk of death from ovarian cancer.
22982218 Data from various thyroid cancer cell lines suggest that PARP inhibition increases NIS (sodium iodide symporter) gene expression through a particular modulation of transcriptional regulatory mechanisms (i.e., specific histone modifications).
22948662 Activated PARP-1 contributes to the displacement of histone H1 and is essential for regulation of the majority of hormone-responsive genes and for the effect of progestins on cell cycle progression
22944692 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
22926545 Data indicate that daidzein induced a change in the Bax/Bcl-2 ratios and activation of caspases-3 and -9 and the cleavage of PARP, and therefore has the potential for use as a therapeutic agent for the treatment of gastric carcinoma.
22880082 The human nuclear poly(ADP-ribose)polymerase-1 (h PARP-1) protein participates in the regulation of the h c-myc gene expression through its interaction with this guanine-quadruplex structure.
22864776 level of PARP-1 protein nuclear expression is associated with the tumor site and heterogeneous across clinical specimens of colorectal cancers
22854955 full-length PARP-1 prefers nucleosomes with two linker DNA extensions over any other substrate (including several free DNA models) and that the C-terminal half of PARP-1 is necessary for this selectivity.
22844406 a novel mechanism whereby polyADP-ribosylation regulates transcriptional activities of HOX proteins such as HOXB7 and HOXA7
22820184 These results demonstrate that PARP1 regulates expression of SH3BP2.
22753495 Overexpression of SIRT6 in "middle-aged" and presenescent cells strongly stimulated homologous recombination repair, and this effect was dependent PARP1.
22683995 Along with functional analysis of PARP1 recruitment to sites of DNA damage in vivo, the structure reveals a dimeric assembly
22660976 Review of recent progress on the role of PARP1 in the DNA damage response and PARP inhibitors in cancer therapy.
22624032 PARP-1 Val762Ala polymorphism is associated with risk of cervical carcinoma.
22586318 Current developments concerning PARP inhibitors in BRCA-associated cancers.
22582261 crystal structure of a DNA double-strand break in complex with PARP-1 domains essential for activation (Zn1, Zn3, WGR-CAT); results suggest that an increase in catalytic domain (CAT) protein dynamics underlies the DNA-dependent activation mechanism of PARP-1
22550344 The role of NADPH oxidase/gp91(phox) expression and the PARP-1/PAR pathway of apoptosis in acute meloid leukemic cells was investigated.
22542292 Data show that RECQ1 associates with PARP-1 in nuclear extracts and exhibits direct protein interaction in vitro.
22472897 PARP-1 gene is expressed in GBM. This finding may be envisioned as an attempt to trigger apoptosis in this tumor, as well as in many other malignancies
22454210 Studied expression of BAG-1 and PARP-1 in LSILs, HSILs and SCCs. Research suggests BAG-1 expression could contribute to the differentiation between LSIL and HSIL/SCC whereas PARP-1 could be useful to the differentiation between HSIL HPV-related and SCC.
22451931 Cellular expression of caspase-7 lacking the critical lysine residues resulted in less-efficient PARP and p23 cleavage compared with cells expressing the wild-type peptidase.
22450322 the present study highlights the extent and topology of PARP-1 and its relation to stenosis in tricuspid aortic valve and identifies the proinflammatory mediator LTC4 as a potent inducer of PARP-1.
22447567 findings not only show that Mre11 activity is required for the survival of BRCA2 mutant cells but also elucidate roles for both the BRCA2 and PARP1 proteins in protecting stalled replication forks
22392482 PARP inhibiton cytotoxicity in BRCA1-deficient tumor cells is enhanced >10-fold when combined with interferon-gamma.
22387748 Low concentration of arsenite reduces UV-induced apoptosis via inhibiting PARP-1, thus promoting the survival of cells with unrepaired DNA lesions.
22384823 Our analysis shows that nuclear PARP is an independent prognostic marker in pancreatic cancer
22344029 Data show that RBMX accumulated at DNA lesions through multiple domains in a poly(ADP-ribose) polymerase 1-dependent manner and promoted HR by facilitating proper BRCA2 expression.
22337872 The interaction between CHFR and PARP-1 plays an important role in cell cycle regulation and cancer therapeutic strategies.
22334709 Our studies link the enzymatic activities of NMNAT-1 and PARP-1 to the regulation of a set of common target genes through functional interactions at target gene promoters.
22227934 An expression level more than double the normal level is associated with a severe intellecual disability phenotype in patients with Down's syndrome.
22221038 Data suggest that the PARP1 2819G allele is associated with an increased risk of gastric cancer.
22216281 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
22198485 This study evaluated the role of PARP1 in the regulation of cellular energetics in endothelial cells under resting conditions and during oxidative stress.
22193445 Inhibition of PARP-1 could decrease tau phosphorylation in HEK293/tau441 cells probably through decreasing GSK-3 activity.
22166496 findings demonstrated an association with increased bladder cancer risk with PARP1 rs8679 while variant homozygotes of PARP1 rs8679 were also noted to have an increased breast cancer risk.
22158865 model in which small molecule inhibitors convert PARP1 into a protein that potentiates the effects of topoisomerase I poisons by binding to damaged DNA and preventing its normal repair.
22153339 analysis of novel poly(ADP-ribose) polymerase-1 inhibitors
22134241 the combination of Chk1 and PARP1 inhibition selectively radiosensitizes p53 mutant pancreatic cancer cells.
22127734 an association of the PARP-1 V 762A polymorphism with increased risk of cancer among Asians, but decreased risk of cancer among Caucasians, particularly of glioma
22120020 Reduced expression of PARP1 is associated with an impairment of CLL responsiveness to cell death.
22101337 Poly(ADP-ribose) polymerase inhibition enhances DNA damage responses via multiple damage response pathways in p53-dependent and -independent fashion.
22057269 OGG1 binding to PARP-1 plays a functional role in the repair of oxidative DNA damage.
21997878 FGF-ERK regulates PARP-1 activity during human embryonic stem cell neural differentiation.
21986234 Letter/Case Report: LDOC1/PARP1 are down-regulated in melanoma with repeated in-transit metastases.
21976405 Constitutive aberrant expression of PARP-1 and RasGRP-1 ratio may act in concert to impair survival of lymphocytes in systemic lupus erythematosus patients.
21945626 PARP-1 enhances the mismatch-dependence of 5'-directed excision in human mismatch repair in vitro.
21915713 PARP-1 suppressed MMP9 expression in undifferentiated, non-apoptotic keratinocytes.
21908496 Nuclear PARP-1 is overexpressed during the malignant transformation of the breast, particularly in triple-negative tumors, and independently predicts poor prognosis in operable invasive breast cancer.
21858164 Data show that that DNA repear process is dictated by PARP1 through its interaction with the chromosome-targeting domain of the hCAP-D2 subunit of condensin I.
21849329 High poly(ADP-ribose) polymerase is associated with high-grade glioma.
21775006 Immunohistochemical staining intensities of PARP-1 and DNA-PK were determined (score 0-3) and expression levels were correlated with /glioblastoma multiforme patients overall survival.
21767974 We conclude that, despite previous evidence, PARP1 is not a susceptibility gene for Parkinson's disease in our population
21756783 PARP1 could regulate DNA methylation by inhibiting the enzyme activity of DNMT1 in bronchial epithelial cells exprosed to B(a)P.
21730054 the PKCdelta/ERK/poly(ADP-ribose) polymerase-1 signaling pathway is involved in histamine- or PMA-induced up-regulation of H1R gene expression in HeLa cells
21729562 Erythropoietin can inhibit the expression of IL-6 and TNF-alpha in monocytes, and the inhibition of IL-6 expression may be associated with decrease of PARP level.
21680843 results indicate that SIRT6 physically associates with PARP1 and mono-ADP-ribosylates PARP1 on lysine residue 521, stimulating PARP1 poly-ADP-ribosylase activity and enhancing DSB repair under oxidative stress
21674737 Both chemical inhibition of PARP1 and PARP1 depletion using small hairpin RNA enhance integration of the Adeno-associated virus type 2 genome in HeLa cells.
21646373 the poly(ADP-ribose) polymerase-1 (PARP-1)/nuclear factor-kappaB (NF-kappaB) signaling cascade, activated during senescence, drives the formation of a secretome endowed with protumoral and prometastatic properties.
21644054 is a key player of head and neck squamous cell carcinoma and Parkinson disease through regulation of apoptosis pathway.
21612407 The PARP1 rs1136410 genotype was significantly associated with the frequency of lymphatic metastasis of gastric cancer, LNM stage & tumor invasion. Epistasis between PARP1 rs1136410 and MMP2 rs243865 increased the risk of LNM of GC.
21607289 Data suggest the therapeutic use of cordycepin for the treatment of BRCA1-deficient breast cancers by inhibiting poly(ADP-ribose) polymerase.
21605336 VEGF exerts its antiapoptotic effect on the endothelium through the regulation of PARP expression. PARP promotes vascular endothelial integrity in VEGF-associated processes.
21577210 PARP-1 (but not PARP-2) poly(ADP) ribosylates Snail1, both in vivo and in vitro, and interacts with Snail1, an association that is sensitive to PARP inhibitors.
21575865 Pharmacological inhibition of PARP1 inhibits ETS-positive, but not ETS-negative, prostate cancer xenograft growth.
21568846 APE1 is shown to decrease the amount of apurinic/apyrimidinic containing DNA-bound PARP1 dimer.
21555554 Data show that hyperthermia (41-42.5 degrees C) induces degradation of BRCA2 and sensitize innately HR-proficient tumor cells to PARP-1 inhibitors.
21547351 Over expression of LDOC1 may explain the clinical manifestation found in patients with cryptochidism and Digeorge anomaly.
21532888 demonstrates that p38gamma MAPK is a promising target for the design of targeted therapies for basal-like breast cancer with metastatic characteristics and for overcoming potential resistance against the PARP inhibitor
21518760 PARP-1 as a novel KLF8-binding and -regulating protein and provided new insights into the mechanisms underlying the regulation of KLF8 nuclear localization, stability, and functions.
21489980 methylation of the TM promoter is responsible for silencing of TM expression in MM tissue, a process that is regulated by PARP1.
21487248 Loss of function of various proteins involved in double strand break repair other than BRCA1/2 has been suggested to be synthetically lethal with PARP inhibition.
21476963 [review] PARP-1 plays a pivotal role in the balance between pro-inflammatory/effector and anti-inflammatory/regulatory responses.
21469519 PARP-1 activity in lower grade neoplasms was higher than in G3 tumors and was lower in adenocarcinomas displaying deep uterine wall infiltration; 4. there was no relationship between PARP-1 activity and AP level.
21460625 C42 enhances the cellular autophagic process, which requires both PARP and RIP-1 participation, preceding and possibly augmenting, the caspase-dependent apoptotic cell death
21447796 A model has been proposed in which increased abundance of c-MYC indirectly leads to decreased BIN1 expression, in turn leading to increased PARP activity and resistance to DNA-damaging agents.
21434873 lack of any association between PARP-1 activity and genotype or sex in cancer patients may indicate additional factors (e.g. stress hormones, interaction with other proteins and post-translational modifications) may play a role in PARP-1 activation
21424107 Studies indicate that siRNA and deletion mutations that interference with PARP-1 function results in enhanced cell death.
21293287 overexpression of PARP and p53 in high grade, and advanced stage epithelial ovarian tumors indicated that these 2 markers might serve as an indicator of aggressive disease behavior
21266351 hPuf-A may regulate cellular response to genotoxic stress by inhibiting PARP-1 activity and thus preventing PARP-1 degradation by caspase-3.
21256093 the mechanism by which PARP-1 is promoting mutagenic repair is by inhibiting high-fidelity repair which would otherwise be mediated by Ku70 and Lig4
21224467 The novel interaction of HES1 and PARP1 in B-cell acute lymphoblastic leukemia modulates the function of the HES1 transcriptional complex and signals through PARP1 to induce apoptosis
21187397 siParp1 inhibits cell growth, primarily by induction of apoptosis, in Brca1-deficient cells both in vitro and in vivo
21183686 Zn1, Zn2, and a domain identified in this study, the double-stranded DNA binding (DsDB) domain, are involved in DNA break-dependent activation of PARP-1 and Zn3 binds ssRNA
21127267 PARP-1 was only weakly activated to conduct poly(ADP-ribose) synthesis upon binding to AP site-containing DNA, but was strongly activated for poly(ADP-ribose) synthesis upon strand incision by AP endonuclease 1 (APE1).
21095583 PARP-1 dissociates Smad complexes from DNA by ADP-ribosylating Smad3 and Smad4, which attenuates Smad-specific gene responses and TGF-beta-induced epithelial-mesenchymal transition.
21037106 We report an association between the PARP Val762Ala single nucleotide polymorphism on the effect of diets higher in high-temperature cooked red meat on colorectal cancer risk
21037106 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21031461 Poly(ADP-ribose) polymerase 1 is involved in glucose toxicity through SIRT1 modulation in HepG2 hepatocytes
20977936 The rate-limiting factor in poly(ADP-ribose)-mediated proteasomal activation in oxidative stress is PARP-1 and not the nuclear proteasome itself.
20967817 Data indicate that there was nonpreferential distribution of PARP1 fluorescence in the perinuclear cytoplasmic region, as well as in the nucleus
20953586 investigation of regulation of gene expression of PARP1 in lung cells in response to DNA damage; expression levels varied between different patients in cells cultured from patient lung tissue
20950443 Sorafenib displays significant antiproliferative effects and induces apoptosis via caspase 3, 7 and PARP in B- and T-lymphoblastic cells
20940411 Utilization of beta-lapachone as a radiosensitizer in prostate cancers that overexpress PARP1.
20876582 Binding of PARP-1 plays a functional role in the barrier activity of chromatin insulator.
20875401 The signaling network between topoisomerase 1 and poly(ADP-ribose) polymerase in carcinoma cell lines is described.
20868244 XRCC1 Arg399Gln polymorphism is a significant risk factor, and 399Gln (G) allele carries a 3.5 times greater risk for glioma, while PARP1 Val/Ala genotype may be protective against it.
20837404 Observational study of gene-disease association. (HuGE Navigator)
20832725 PARP-1 regulates chromatin structure and transcription through a KDM5B-dependent pathway.
20823142 Poly (adp-ribose) polymerase as a novel therapeutic target in cancer.
20817730 Cooperative role of NF-{kappa}B and poly(ADP-ribose) polymerase 1 (PARP-1) in the TNF-induced inhibition of PHEX expression in osteoblasts.
20731661 Findings suggest that PARP1, XRCC1, MGMT, XPC, XPD and MSH2 SNP can be used as prognostic markers for patients with surgically resected early stage NSCLC.
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20711239 We propose a model in which both CtBP and PARP functionally interact in a corepressor complex as components of a molecular switch necessary for p21 repression.
20665026 Despite a possible association between PARP-1 and the radiological severity of rheumatoid arthritis (RA), there is no statistical association between PARP-1 polymorphisms and the susceptibility to rheumatoid arthritis in a Korean population.
20665026 Observational study of gene-disease association. (HuGE Navigator)
20652015 The PARP-1 BRCT domain has a specialized role in assembling mutagenic DNA repair complexes involved in antibody diversification.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20629644 expression of PARP, Bak and p53 was significantly greater for patients afflicted with varicocele than was the case for the normal controls
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619687 inducible nitric oxide synthase colocalizes with poly(ADP-ribose) polymerase-1 within vascular cells of atherosclerotic aortae
20603072 Recent studies have begun to connect the molecular functions of PARP-1 to specific physiological and pathological outcomes, many of which can be altered by an expanding array of chemical inhibitors of PARP enzymatic activity.
20587588 A ChIP survey showed significantly higher recruitment of PARP1, a protein identified by MS as ubiquitously attached to DNA probes, within heterochromatin sites.
20574454 Observational study of gene-disease association. (HuGE Navigator)
20573551 The observations support the model that persistence of PARP-1 at base excision repair intermediates, as cells move into S-phase, leads to DSBs and the attendant checkpoint responses.
20564216 Findings indicate that PARP-1 is a component of BCL2 37 mbr-protein complexes, and PARP-1 is involved in the regulation of BCL2 expression.
20561897 Mice with ectopic expression of human PARP-1 had impaired DNA repair, accompanied by a continuous low-level increase in pro-inflammatory stimuli, causing development of chronic diseases leading to impaired survival.
20559012 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20550106 these results reveal the unique binding properties for binding of PARP-1 to platinum-DNA damage, providing insights into, and a better understanding of, the cellular response to platinum-based anticancer drugs.
20544540 Lower PARP-1 activity and higher NAD concentration were observed in systemic sclerosis and lupus erythematosus, supporting the role of PARP-1 activation in modulating NAD concentration.
20522537 Observational study of gene-disease association. (HuGE Navigator)
20514865 analysis of poly(ADP-ribose) polymerase 1 interaction with apurinic/apyrimidinic sites
20495366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20493910 Importance of Parp-1, APEX-1 and ERK1/2 catalytic activities in the growth arrest-induced apoD gene expression.
20493163 the SIRT1-PARP-1 axis plays a critical role in the regulation of cigarette smoke(CS)-induced autophagy and has important implications in understanding the mechanisms of CS-induced cell death and senescence
20486200 Single nucleotide polymorphisms of the PARP-1 gene are highly associated with Alzheimer's disease susceptibility in a Taiwanese population and might contribute to a critical mechanism that mediates cell survival or death as a response to cytotoxic stress.
20486200 Observational study of gene-disease association. (HuGE Navigator)
20473728 PARP-1 inhibitors, in conjunction with platinum derivatives, were found to exhibit significant survival benefit over chemotherapy alone even in a relatively small phase II study.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20404718 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
20399804 the difference between a long-lived and a short-lived species tested, man and rat, is directly mirrored by the enzymatic parameters of recombinant PARP-1.
20388712 the Zn3 domain has dual roles in regulating the functions of PARP-1
20373286 Aurora-A expression inhibits RAD51 recruitment to DNA double-strand breaks, decreases double-strand break repair by homologous recombination and sensitizes cancer cells to PARP inhibition.
20353610 association of nine single nucleotide polymorphisms in ADPRT1, AKR1B1), RAGE, GFPT2 and PAI-1 genes with chronic renal insufficiency among Asian Indians with type 2 diabetes
20353610 Observational study of gene-disease association. (HuGE Navigator)
20232390 Observational study of gene-disease association. (HuGE Navigator)
20223788 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20219917 PARP1-dependent PARylation of EBNA1 and adjacently bound TRF2 induces structural changes at the dyad symmetry element that reduce EBNA1 DNA binding affinity and functional recruitment of origin recognition complex.
20218899 XRCC1 and APE1 polymorphisms may contribute to susceptibility to bladder cancer.
20196871 The present data suggest that Val762Ala, Asp81Asp, and Lys352Lys polymorphisms and the haplotype-ACAAC in PARP-1 are associated with reduced risk of non-hodgkins lymphoma in Korean males.
20196871 Observational study of gene-disease association. (HuGE Navigator)
20181890 the -1082G > A alleles in promoter region of IL10 gene interact with PARP-1 in an allele-specific manner resulting in different levels of IL-10 transcription; PARP-1 DNA-binding activity is regulated in macrophages that engulf apoptotic cells
20177052 Poly(ADP-ribose) polymerase (PARP)-1-independent apoptosis-inducing factor (AIF) release and cell death are induced by eleostearic acid and blocked by alpha-tocopherol and MEK inhibition.
20150366 Observational study of gene-disease association. (HuGE Navigator)
20145242 Trypanosoma cruzi induces the reactive oxygen species-PARP-1-RelA pathway for up-regulation of cytokine expression in cardiomyocytes
20137830 PARP1 and telomeric repeat binding factor (TRF)1 are overexpressed in muscle from Duchenne muscular dystrophy patients.
20124459 ATM deficiency sensitizes mantle cell lymphoma cells to poly(ADP-ribose) polymerase-1 inhibitors
20113831 The SNPs of the PARP1 gene, as well as differences in the levels of PARP-1 and poly(ADP-ribosyl)ation of proteins, may influence germ cell tumor development and responses to chemotherapy and radiotherapy.
20113831 Observational study of gene-disease association. (HuGE Navigator)
20072652 Data show that LLL12 inhibited STAT3 phosphorylation, induced apoptosis as indicated by the increases of cleaved caspase-3 and poly (ADP-ribose) polymerase, and also downregulated cyclin D1, Bcl-2, and survivin at both protein and messenger RNA levels.
20068062 Damage-independent activation of caspase-3 and PARP in FA cells, which seems to occur through mitogen-activated protein kinase activation and TNF-alpha oversecretion.
20064938 the interaction between PARP-1 and PARP-3 is unrelated to DNA single-strand break repair
20060806 these data suggest that environmental/oxidant stress-induced SIRT1 down-regulation and PARP-1 activation are independent events despite both enzymes sharing the same cofactor.
20025963 role in proteasome activation and chromatin repair after oxidative stress
20016407 Observational study of gene-disease association. (HuGE Navigator)
19996272 Studies show that BMS-754807 is a reversible inhibitor of the insulin-like growth factor 1 receptor/insulin receptor and increases poly ADP ribose polymerase and Caspase 3 cleavage.
19962992 model in which PARP-1, upon binding DNA, undergoes a conformational change to become an active nuclear enzyme
19961617 The review elaborates on the role played by PARP during spermatogenesis, sperm maturation in ejaculated spermatozoa and the potential role of PARP as new marker of sperm damage
19925161 We conclude that after severe TBI in humans, a PARP-1 polymorphism within the automodification-catalytic domain is associated with neurological outcome, while a polymorphism within the promoter region was associated with CSF PAR-modified protein level.
19925161 Observational study of gene-disease association. (HuGE Navigator)
19916945 Top1 and DNA adducts complex formation was partial inhibited by addition of PARP1 in the absence of NAD+.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19897724 Data show that the intrinsic poly(ADP-ribosyl) polymerase activity of PARP-1 is activated by a heat- and protease-sensitive H. pylori factor, resulting in automodification of PARP-1 with polymers of poly(ADP-ribose)
19877712 Expression of human PARP-1 in Saccharomyces cerevisiae delays the yeast cell cycle at the second gap phase (G2) of mitosis and may affect ribosome biogenesis by modifying certain nucleolar proteins in yeast.
19863315 We found that the longer alleles (CA)17-20 had a very low frequency in BMD (2/160, 1.3%, OR=7.33 (1.77-30.37, 95% CI), corrected p=0.012), suggesting that it may confer some protection against BMD.
19863315 Observational study of gene-disease association. (HuGE Navigator)
19812418 PARP-1 and PARG, nuclear enzymes with opposing enzymatic activities, localize to target promoters and act in a similar, rather than antagonistic, manner to regulate gene expression
19809895 Data show that keratinocytes and melanocytes display an exquisite vulnerability to nanomolar concentrations of ZnPT resulting in induction of heat shock response gene expression, PARP-dependent energy crisis and impaired genomic integrity.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19784808 Data show that inhibition of NFAT3 activation by shNFAT3 significantly downregulated tumor necrosis factor (TNF)-alpha induction, its receptor TNFR1, caspase 10, caspase 3, and poly (ADP-ribose) polymerase.
19784367 Poly[ADP-ribose] polymerase-1 expression is related to cold ischemia, acute tubular necrosis, and delayed renal function in kidney transplantation
19779455 PARP-1 transcriptional activity is regulated by sumoylation upon heat shock.
19723035 Study analyzed the distribution of PARP-1 and its interaction with CENP-B, -E, and -F during mitosis and apoptosis.
19711368 poly(ADP-ribose) polymerase-1 has roles in modulating the mode of cell death caused by continuous oxidative stress
19703477 PARP1 differentially influences DNA synthesis in SP- and LP BER pathways.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19684606 Toll-like receptor 2 and poly(ADP-ribose) polymerase 1 promote central nervous system neuroinflammation in progressive experimental autoimmune encephalomyelitis.
19680243 Study identifies macrodomains as modules that directly sense PARP activation in vivo and establish macroH2A histones as dynamic regulators of chromatin plasticity.
19666485 Poly(ADP-ribosyl)ation directs recruitment and activation of the ATP-dependent chromatin remodeler ALC1
19655414 Results demonstrated the augmented adjuvant anti-tumor effects of AC-CF not only through down regulation of MDR-1 expression but also through a COX-2 dependent apoptosis pathway, involving down-regulation of COX-2 and p-AKT and up-regulation of PARP-1.
19643912 Data demonstrate the presence of elevated levels of oxidative DNA damage in AOA1 cells coupled with reduced base excision and gap filling repair efficiencies indicative of a synergy between aprataxin, PARP-1, APE-1 and OGG1 in the DNA damage response.
19636556 Data show that with SF1126 treatment, caspase 3 and PARP proteins were cleaved, survivin was down-regulated, and inhibition of PI3-kinase was confirmed by reduced phosphorylation of Akt.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19607827 Data show that Parp2 interacts significantly with both the transition protein TP2 and the transition chaperone HSPA2, whereas Parp1 binds weakly to HSPA2.
19604089 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19585117 Data show that oroxylin A enhanced 5-FU-induced apoptosis by elevating the expressions of apoptotic-inducing proteins P53 and cleaved PARP and decreasing the expression of apoptotic-inhibitory proteins COX-2, Bcl-2, and pro-caspase3.
19568233 The mean activity pf PARP-1 in cancer cells was 45-fold higher than the mean activity in normal human lymphocytes and the PARP-1 protein levels were 23-fold higher.
19553815 Studies indicate poly (ADP-ribose)-polymerase inhibitors that targeting one form of DNA repair profoundly affect cell survival in those with a hereditary failure to mend DNA damage using another mechanism.
19544333 Data show that IP6 caused a strong apoptotic death of PC-3 cells together with caspase 3 and PARP cleavage.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19529948 In 13 fatal ischemic stroke cases, the number of PARP-1 immunoreactive neurons was highest in the periinfarct area. Nuclear PARP-1 correlated with increasing neuronal necrosis. Cytoplasmic cleaved PARP-1 inversely correlated with increasing necrosis.
19515826 PARP-1 interacts with the C-terminal domain of nsP3 during virus amplification.
19513550 gammaH2AX and cleaved PARP-1 as apoptotic markers in irradiated breast cancer BT474 cellular spheroids.
19506301 The N-terminal GzmA cleavage fragment of PARP-1 acts as a PARP-1 dominant negative, binding to DNA and blocking DNA repair.
19484672 PARP-1 polymorphism may be one of the factors participating in protection or susceptibility to asthma in turkish population.
19484672 Observational study of gene-disease association. (HuGE Navigator)
19447888 Poly(ADP-ribose) polymerase-1 positively regulates micro opioid receptor (MOR) gene transcription via G-172 T.
19372636 study performed on 33 centenarians and 66 subjects of age ranging from 12 to 80 years shows that circulating autoantibodies to the nuclear enzyme PARP-1 are present in the sera of normal healthy people and increase with age
19369898 The allele frequencies for PARP1 762Ala was 0.04025 in vinyl chloride exposed workers.
19369898 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19368128 Significant anti-PARP 1 activity was found to be an ADV-RSV-TK treatment effect after acyclovir addition.
19344625 PARP-1 acts as novel node within the RAS network based on its ability to regulate downstream targets such as AT2R and its adapter protein ATBP
19281796 These results suggest that PARP-1 acts as a corepressor for FOXO1, which could play an important role in proper cell proliferation by regulating p27(Kip1) gene expression.
19247804 16HBE and its PAPR1-deficient cells were exposed to BaP. Compared with 16HBE, the PARP1-deficient cells were more sensitive to the DNA damage caused by BaP.
19181665 NRF-1 can also directly interact with poly(ADP-ribose) polymerase 1 (PARP-1) and co-purify the PARP-1.DNA-PK.Ku80.Ku70.topoisomerase IIbeta-containing protein complex.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19147860 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19144573 Delocalization of PARP-1 from the nucleolus to the nucleoplasm sensitizes cells to DNA damage-induced apoptosis. Nucleolar PARP-1 could participate in a process involved in nucleolus-mediated stress sensing.
19139632 PARP-1 possesses a dual role in modulating necrosis and autophagy under oxidative stress and DNA damage.
19124499 The PARP1 SNP A762V showed a significant association with glioma risk.
19124499 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19109787 overall genomic epidemiology review on associations between genes in the base excision repair pathway and cancer risk, focusing on genes encoding three key enzymes in this repair pathway: ADPRT, XRCC1, and XPD
19103807 The expression of human PARP-1 restores fork slowing in PARP-1(-/-) DT40 cells. PARP-1 affects SSB repair, homologous recombination (HR), and nonhomologous end joining.
19087198 Drugs inhibiting PARP-1 may represent valuable tools for pharmacological treatment of stroke patients.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19060926 Ionizing radiation-induced NF-kappaB activation requires PARP-1 function to confer radioresistance
19056730 arsenite inhibits oxidative DNA damage repair and suggest that interaction of arsenite with the PARP-1 zinc finger domain contributes to the inhibition of PARP-1 activity by arsenite.
19030862 For our Turkish sample, the V762A polymorphism of the PARP-1 may not be involved in susceptibility to RA, implying that the polymorphism may not function as a candidate gene marker for screening RA patients.
19030862 Observational study of gene-disease association. (HuGE Navigator)
19029194 Observational study of gene-disease association. (HuGE Navigator)
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18996291 Data show that overexpressed PARP-1 promotes PARP-1/NF-kappaB/DNA complex formation, enhancing the expression of TNF-alpha and IL-6 in circulating mononuclear cells of unstable angina patients.
18990703 Parp-1 down-regulates BRCA2 expression through an interaction with a repression region of the BRCA2 promoter
18954712 The results of our study have shown that KU-0059436 increases radiosensitivity in a replication-dependent manner that is enhanced by fractionation.
18779313 This variant can interact with ADPRT-762Ala variant to further substantially increase susceptibility to the disease and regional LN metastasis.
18779313 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18773488 ILK silencing inhibited binding of PARP-1 to SIRE
18768662 Results suggest that PARP1 behaves as an important negative co-factor involved in the regulation of Pax8-dependent gene expression.
18752052 Over-expression of PARP-1 was correlated with recurrence and/or progression of cutaneous malignant melanomas.
18716896 PARP-1 762Ala/Ala could be a risk factor for gastric cancer in Han Chinese population; PARP-1 762Val/Ala polymorphism and Cag(+) H. pylori infection jointly contribute to higher risk for gastric cancer
18716896 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18695944 Results indicate that inhibition of PARP-1 by benzamide and 4-amino-1,8-naphthalimide results in induction of apoptosis.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18676402 Vitamin A depletion causes oxidative stress, mitochondrial dysfunction, and PARP-1-dependent energy deprivation
18676401 The histone subcode: poly(ADP-ribose) polymerase-1 (Parp-1) and Parp-2 control cell differentiation by regulating the transcriptional intermediary factor TIF1beta and the heterochromatin protein HP1alpha
18663363 PARP-1 is the PARP family member playing the most prominent role in the upregulation of c-Fos and c-Myc during G0-G1 transition.
18636124 Observational study of gene-disease association. (HuGE Navigator)
18619636 Low concentration of arsenite exacerbates UVR-induced DNA strand breaks by inhibiting PARP-1 activity.
18599483 during conditions of oxidative stress in lymphocytes, TRPM2 acts as a downstream effector of the PARP/poly(ADP-ribose) glycohydrolase pathway through PARP-dependent formation of ADP-ribose.
18587655 PARP-1-but not PARP-2-is required for proper expression of major genes involved in regulation of apoptosis
18506195 As PAR-modified protein concentration correlated with age and male sex, developmental and sex-dependent roles for PARP after TBI are implicated.
18483312 Observational study of genotype prevalence. (HuGE Navigator)
18452307 human poly(ADP-ribose) polymerase-1 domain C is important for enzyme activity and contains a novel zinc-ribbon motif
18445785 TFII-I, PARP1, and SFPQ proteins, each previously implicated in gene regulation, form a complex controlling transcription of DYX1C1. Allelic differences in the promoter or 5'UTR of DYX1C1 may affect factor binding and thus regulation of the gene.
18439038 presence of heat-labile sites has a substantial impact on DSB induction and DSB rejoining rates measured by pulsed-field gel electrophoresis, and heat-labile sites repair is independent of DNA-PKcs, XRCC1 and PARP
18376143 PARP activity determines the fate of HeLa cells by regulating the level of ATP after treatment with MNNG
18357393 Observational study of gene-disease association. (HuGE Navigator)
18347181 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18339380 Determination of Poly (ADP-ribose) polymerase (PARP) homologues in human ejaculated sperm and its correlation with sperm maturation.
18338862 hPARP-1 gets catalytically activated upon binding to G-quadruplexes localized at the c-kit promoter and human telomere regions
18330920 Observational study of gene-disease association. (HuGE Navigator)
18314489 These findings strengthen the importance of the role of PARP1 as a transcriptional coactivator of HIF-1-dependent gene expression during tumor progression.
18312852 These results give the first direct demonstration that PEDF might represent a target for PARP inhibition treatment and the effects of PEDF on endothelial cells growth are context dependent.
18279607 The decreased expression of hOGG1 and ADPRT might be closely related to the development of nasopharyngeal carcinoma.
18258916 histone H1 & PARP-1 exhibit a reciprocal pattern of chromatin binding at many RNA polymerase II-transcribed promoters; study showed PARP-1 acts to exclude H1 from a subset of PARP-1-stimulated promoters
18230337 Our results indicate that nicotinamide treatment attenuates p21WAF1 expression through Sp1 downregulation, and suggest a possible involvement of nicotinamide metabolism in cellular gene expression.
18164959 caspase-3 activation by RSVL is required for PARP degradation and induction of apoptosis
18078995 These data point to PARP-1 and poly(ADP-ribosyl)ation as a novel regulatory mechanism of NFAT at nuclear level.
18073140 The nuclear binding site of PARP-1 is Topo I, and is identified as a critical "switchpoint" indicating the nuclear element that connects OXPHOS with mRNA synthesis in real time.
18055453 demonstrate using spectroscopic and crystallographic analysis that human PARP-1 has a third zinc-binding domain
18054777 These results highlight a new role of the PARP-1 protein on the synapsis of DSBs and could explain why the PARP-1 NHEJ pathway is strongly dependent on the DSBs microhomology sequence.
18054108 Results suggest that the PARP1 gene is involved in the pathogenesis of diabetic neuropathy in a Russian population.
18054108 Observational study of gene-disease association. (HuGE Navigator)
18025084 Poly(ADP-ribose) polymerase 1 (PARP1) is a nuclear enzyme that is rapidly activated by DNA strand breaks and signals the presence of DNA lesions by attaching ADP-ribose units to chromatin-associated proteins.
18006925 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17975135 poly(ADP-ribose) polymerase has a role in excision repair of single-strand breaks; review of its inhibitors and their use in cancer therapy [review]
17943227 detailed mutation and haplotype tagging analysis of the ADPRT gene with regard to breast cancer
17908769 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17900801 AG490 enhances UCN-01-induced cytotoxicity in p53 defective cell lines by suppression of BAD phosphorylation and induction of BAX and PARP cleavage
17889105 Kidney transplant events including ischemia were associated with the highest PARP-1 expression and worse allograft renal function.
17884996 The results of this study indicate that specific flavonoids have PARP-1-inhibiting activity and that this could play a role in the anti-inflammatory activity of these compounds.
17785446 These results show that the DNA binding domain and catalytic domain cooperate to regulate chromatin structure and transcription, providing mechanistic insights into how these domains contribute to the chromatin-dependent functions of PARP-1.
17703177 molecular evidence presented that the differential apoptotic cell-induced IL-10 gene expression in individuals with the GCC or ATA promoter haplotypes is determined at the level of transcription mediated by PARP-1
17616514 Results identified nuclear protein poly (ADP-ribose) polymerase family, member 1 (PARP1) as a nuclear protein binding to the SMARCB1 promoter and showed that the -228 SNP significantly altered PARP1 binding affinity.
17596754 PARP activity has an important role in providing the retinal pigment epithelium with the high oxidative tolerance required for this cell type to survive the constant reactive oxygen species attack in vivo for several decades.
17562258 PARP activity is enhanced in colorectal carcinoma, and is inhibited by 5-aminoisoquinolinone.
17560163 Observational study of gene-disease association. (HuGE Navigator)
17560163 Genetic variants of PARP-1 may contribute to breast cancerogenesis; PARP-1 htSNP c.852T>C (Ala284Ala) may influence hormonal therapy of breast cancer.
17548475 PARG is identified as a novel and critical component of single-strand break repair that accelerates this process in concert with PARP-1.
17540609 In diabetic patients, FPG-sensitive DNA strand breaks correlated positively with PARP gene expression, PARP activity and NFkappaB binding activity.
17529993 SET and PARP1 remove DEK from chromatin to permit access by the transcription machinery
17518695 cells from old subjects show a constitutive expression level of both parp 1 and parp 2 genes reduced by a half
17459151 while PARP-1 is needed in the response of ATM to gamma irradiation, the inhibition of PARP induces DNA double strand breaks
17428792 physical interaction between the major DSB signaling kinase, ATM and poly(ADP-ribosyl)ation by PARP-1, a key enzyme of chromatin remodeling.
17413981 This study indicates that PARP expression is frequently upregulated in ovarian serous carcinomas, related with MIB-1 LIs and p53 expression, and may serve as a marker of aggressive behavior with prognostic value.
17385326 Observational study of gene-disease association. (HuGE Navigator)
17362997 Observational study of gene-disease association. (HuGE Navigator)
17362997 A protective effect against PD was found for heterozygosity at (-410) (OR 0.44) and (CA)n microsatellite (OR 0.53) polymorphisms, and heterozygosity at (-1672) polymorphism delayed by 4 years on the onset age of PD.
17360427 depending on its state of phosphorylation, NMNAT-1 binds to activated, automodifying PARP-1 and thereby amplifies poly(ADP-ribosyl)ation
17314023 retrodifferentiation of growth-arrested U937 monocytic cells requires proteasomal protein degradation and activity of PARP-1
17295209 These data imply that PARP activation following exposure to ionizing radiation is enhanced through EGFR-ERK signaling.
17290104 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17290104 PARP-1-410 and PARP-1-1672 haplotypes were associated with an increased risk for AD and, in addition, PARP-1 haplotypes increased the risk of AD by interaction with the IL-1A -889 allele 2.
17283177 Observational study of gene-disease association. (HuGE Navigator)
17225870 These results represent the first direct demonstration of PARP activation in human myocardial infarction.
17220334 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17203305 Observational study of gene-disease association. (HuGE Navigator)
17187679 poly(ADP-ribose)polymerase-1 and Ku70/Ku80 are transcriptional regulators of S100A9 gene expression
17172468 E4orf6 disrupts cellular DSBR signaling by inhibiting PP2A, leading to prolonged H2AX phosphorylation, hyperactivation of PARP, and AIF translocation to the nucleus.
17158748 Upon heat shock, the Hsp70.1 promoter-bound PARP-1 is released to activate transcription through ADP-ribosylation of other Hsp70.1 promoter-bound proteins.
17148781 PARP-1 and Hsp90 bind to TonEBP; PARP-1 expression reduces TonEBP transcriptional activity and the activity of its transactivating domain and Hsp90 enhances those activities.
17088946 The current data provide evidence of oxidative stress and PARP activation in human heart failure.
16920718 Ca(2+) appears to be an important co-factor in PARP-1 hyperactivation after reactive oxygen species-induced DNA damage, which alters cellular metabolism and DNA repair
16890595 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16890595 The ADPRT and XRCC1 polymorphisms confer host susceptibility to GCA, which might result from reduced ADPRT-XRCC1 interaction and attenuated base excision repair capacity.
16889694 Observational study of gene-disease association. (HuGE Navigator)
16628003 AIF-mediated cell death is regulated by the functional interplay of SIRT1 and PARP-1 in response to DNA damage
16627622 These results suggest that PARP1 phosphorylation by ERK1/2 is required for maximal PARP-1 activation after DNA damage.
16621887 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16621887 the APE1 Glu variant, but not an ADPRT variant, may have an effect or interact with XRCC1 in the etiology of cutaneous melanoma or in linkage disequilibrium
16492928 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16461442 Observational study of gene-disease association. (HuGE Navigator)
16429131 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
16412052 Observational study of gene-disease association. (HuGE Navigator)
16405741 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16386505 PARP-1 expression and cold ischemia duration in kidney biopsies with acute tubular necrosis predicted the short-term delay in total recovery of renal function and serum creatinine in the first month.
16364363 Data show that polynucleotide kinase is associated with the PARP-1-dependent end-joining pathway, and show functional parallels between the PARP-1 and DNA-PK-dependent end-joining processes.
16328064 Observational study of gene-disease association. (HuGE Navigator)
16328064 ADPRT Val762Ala and XRCC1 Arg399Gln polymorphisms may not play a role in the etiology of breast cancer.
16323285 Down-regulation of PARP1 in TUR leukemia cells restores transcriptional responsiveness for differentiation and cell cycle arrest.
16306129 Data show that one mechanism through which oxidative stress or TNF-alpha mediates cell death is activation of TRPM2, resulting in increased internal calcium, followed by caspase activation and PARP cleavage.
16284386 Observational study of gene-disease association. (HuGE Navigator)
16262266 Data show that the amino-terminal DNA-binding domain of human PARP-1 binds a 5'-recessed DNA end cooperatively with a stoichiometry of two proteins per DNA molecule.
16212410 nucleolin and poly[ADP-ribosyl] transferase have roles in drug resistance
16207712 PARP activation and the concomitant reduction of Sir2alpha activity in failing hearts regulate the post-translational acetylation of p53
16188097 hPARP-1 protein may play an important role in the adaptive response of cells to hydroquinone.
16179389 The specific inhibition of Aurora-B kinase activity by PARP-1 contributes to the physiological response to DNA damage.
16123586 Although PARP-1 appears not to be required for homologous recombination itself, it regulates the process through its involvement in the repair of DNA single-strand breaks [review]
16115861 PARP inhibition-induced Akt activation is dominantly responsible for the cytoprotection in oxidative stress
16107709 results implicate CSB in the PARP-1 poly(ADP-ribosyl)ation response after oxidative stress and thus suggest a novel role of CSB in the cellular response to oxidative damage
16026592 results provide the first evidence that PARP-1 haplotypes are related with coeliac disease susceptibility
16002043 These results suggest that PARP-1 is required for HIV-1 integration near the centromere region both in human and murine cells.
15940627 expression of PARP-1 was closely associated with the accumulation of beta-catenin and with the undifferentiated status of intestinal epithelial cells; PARP-1 may participate in early colorectal carcinogenesis
15895395 PARP-1-mRNA expression was increased in mononuclear cells from all diabetic patients. Could therefore be responsible for the abnormal inflammation and infection responses in diabetes.
15866623 PARP-1 plays an important role in acute tubular necrosis and recovery of renal function and is related to the extent and severity of ATN and to the renal allograft function.
15826658 Data show that PARP-1 differs from other cruciform-binding proteins by binding to hairpin tips rather than to junctions, and that PARP-1 can interact with the gene regulatory sequences by binding to the promoter-localized cruciforms.
15821886 Anti-La/SSB antibodies were accompanied by significant increased leukocytes (P < .02). PARP cleavage (85 kDa) in nuclei was preferentially observed in cases with nuclear targeting autoantibodies
15819892 PARP-1 binding to DNA single-strand breaks or repair intermediates plays a protective role when repair is limited
15781132 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
15777284 PARP-1 expression appeared to be co-ordinated with that of Sp1 and Sp3 in primary cultured cells, suggesting that PARP-1 may play some important functions during the proliferative burst that characterizes wound healing.
15774926 Observational study of gene-disease association. (HuGE Navigator)
15767427 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
15750180 poly(ADP-ribose) polymerase-1 in the cell nucleus rapidly triggers mitochondrial dysfunction
15743888 PARP-1 is involved in expression of ERBB2 in concert with NF-kappaB, which might be associated with proliferation of rheumatoid arthritis synovial cells.
15737996 the structural features of non-B form DNA co-factors are important for PARP-1 catalysis activated by undamaged DNA
15731342 Interplay between APE1, DNA polymerase beta and poly(ADP-ribose) polymerase-1 during base excision repair.
15729291 PARP-1 activation and a PARP-1-dependent, caspase-independent, nuclear translocation of apoptosis inducing factor contribute to apoptotic cerebral endothelial cell death after ischemia-reperfusion
15705867 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15703174 PARP-1 poly(ADP-ribosyl)ation is a terminal event in the apoptotic response that occurs in response to DNA fragmentation and directly influences DFF40 activity
15672325 The association of different NACP-Rep1 alleles with Parkinson's disease may be mediated, in part, by the effect of PARP-1 on SNCA expression.
15650754 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
15607977 PARP-1 functions both as a structural component of chromatin and a modulator of chromatin structure through its intrinsic enzymatic activity.
15572421 PCNA expression induces apoptosis by up-regulating cleaved caspase-3 and PARP expression and down-regulating Bcl-2 protein expression in leiomyoma cells.
15564335 normal cells but not pituitary tumor cells are able to sufficiently activate PARP to prevent rapid cell death
15536154 Upregulated by cetrorelix in cultured leiomyoma cells.
15498778 poly(ADP-ribose) polymerase-1 and XRCC1/DNA ligase III utilize an alternative route for DNA double-strand breaks rejoining
15498776 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
15489954 Data provide novel insight into the function of poly(ADP-ribose) polymerase-1 (PARP-1) in inflammation and ischemia-related pathophysiologies.
15375506 Increased expression of poly(ADP-ribose) polymerase is associated with hepatocellular carcinoma
15374823 role for PARP in the onset and progression of cardiac hypertrophy; some events related to cardiac hypertrophy growth and progression to heart failure are mediated by a PARP-dependent mechanism.
15342424 Observational study of gene-disease association. (HuGE Navigator)
15331727 PARP1 bound directly to a specific region within the Kaposi's sarcoma-associated herpesvirus (KSHV) terminal repeat sequence
15304054 ICAM-1, VCAM-1, E-selectin and interleukin-6 expression are enhanced by glucose and regulated by poly(ADP-ribose) polymerase in human umbilical endothelial cells
15292449 Poly(ADP-ribose) polymerase 1 inactivates the catalytic activities of the Werner syndrome protein.
15286704 Inhibition of PARP-1 and DNA-dependent protein kinase id a powerful strategy for tumor radiosensitization.
15280503 required for efficient HIV-1 replication in human cells
15257133 Over-activation of PARP can contribute to the pathomechanism of the disease-specific lesion of the neurons in the substantia nigra in Parkinson disease.
15247263 function for the automodification reaction is to regulate the interaction between PARP-1 and Topo I, and consequently, the Topo I activity, in response to DNA damage.
15205355 Observational study of gene-disease association. (HuGE Navigator)
15133513 identify TIN2 as a PARP modulator in the TRF1 complex
15110646 PARP-1 in biopsy specimens from aged donors may be a useful predictive factor for renal graft function.
15103018 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
15019581 PARP-immunoreactivity is increased in reactive astrocytes in the central nervous system of SOD1(G93A) transgenic mice, suggesting a role for PARP-expressing astrocytes in the pathogenesis and progress of amyotrophic lateral sclerosis.
14754756 Data show that poly(ADP-ribose) polymerase 1 (PARP-1) is expressed during fetal development and undergoes complex developmental changes in expression, and that inhibition of PARP-1 activity differentially affects expression of surfactant proteins.
14715657 activity of E. coli topoisomerase I is specifically associated with poly(ADP-ribose) polymerase-1
14699148 PARP-1 and PARP-2 act as positive regulators of genomic stability in eukaryotic cells by counteracting topoisomerase I-induced DNA damage
14642390 nitric oxide and reactive nitrogen oxide species inhibit PARP
14612404 the WRN/PARP-1 complex plays a key role in the cellular response to oxidative stress and alkylating agents, suggesting a role for these proteins in the base excision DNA repair pathway
14596914 interaction of ADPRT and WRN resulting in ADP-ribosylation of the WRN protein; results imply that WRN is involved in DNA replication and in DNA repair
14585985 cellular poly(ADP-ribose) polymerase 1 (PARP-1) and Ste20-like kinase hKFC interact with the serine/threonine-rich region of gamma-2 herpesvirus replication and transcription activator (RTA)
14557488 reduced blood flow and subsequent ischemic damages in leiomyoma could be responsible for PARP overexpression and PAR accumulation, clinical response, and tumor degeneration caused by leuprorelin treatment.
12960163 PARP-1 acts synergistically with p300 and plays an essential regulatory role in NF-kappaB-dependent gene expression
12930846 PARP-1 and p21 could cooperate in regulating the functions of PCNA during DNA replication/repair.
12853070 in the peripheral blood, appears to be present at higher rates in COPD patients than in healthy age-matched controls
12714254 centenarian subjects display low MTmRNA, good zinc ion bioavailability, satisfactory NK cell activity and higher capacity of PARP-1 in base excision DNA-repair.
12704785 examination of binding of central and carboxy-terminal regions p53 protein
12674511 polyADP ribosyl transferase level is linked with the oxidoreduction reactions seen in Fanconi anemia
12673357 PARP-1 does not play a major role in catalysis of DNA damage processing via either base excision repair pathway.
12668662 Translocation of this protein was used to monitor the partial purification of the active components(s) from both human T cell and yeast extracts.
12642583 study establishes poly(ADP-ribose) polymerase-1 as a critical regulator of the protein p53 response to DNA damage
12632415 Observational study of gene-disease association. (HuGE Navigator)
12632415 PARP-1 haplotypes play a role in susceptibility to rheumatoid arthritis.
12606781 Poly(ADP-ribose) polymerase activation and changes in Bax protein expression associated with extracellular ATP-mediated apoptosis in human embryonic kidney 293-P2X7 cells.
12592385 Inhibition of BRCA1 via overexpressing the RHA fragment coincides with a reduction in PARP-1 protein expression. PARP-1 is identified as a downstream effector of BRCA1 function in the maintenance of genomic stability.
12528821 PARP immunoreactivity is increased 3-fold in spinal cord tissues of sporadic amyotrophic lateral sclerosis (sALS) patients compared with non-neurological disease controls, demonstrating a role of glial alterations in sALS pathogenesis.
12496481 TRAIL treatment did not result in PARP cleavage.
12404116 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
12117981 Escherichia coli shiga-like toxins induce apoptosis and cleavage of poly(ADP-ribose) polymerase via in vitro activation of caspases
11956622 PARP expression in Ewing's sarcoma cells
11941587 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11846007 PARP-1 degradation in etoposide-treated apoptotic cells may precede DNA cleavage.
11781832 PARP co-activates B-MYB through enhanced phosphorylation at cyclin/cdk2 sites
11756665 Here, we show that PARP activation reaction in vitro becomes acidic with release of protons during hydrolysis of beta-nicotinamide adenine dinucleotide
11591122 Observational study of gene-disease association. (HuGE Navigator)
11509621 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
11248084 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
11123279 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
11070027 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
10799874 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
10405328 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
9548463 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia
8491200 HIV-1 clade B and C Tat induces cleavage of both PARP and CASP3 in primary glia

AA Sequence

MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVE      1 - 70
VDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLS     71 - 140
KKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKG    141 - 210
DEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAIL    211 - 280
DRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKV    281 - 350
KKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT    351 - 420
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPV    421 - 490
EVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLV    491 - 560
DIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKN    561 - 630
FTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK    631 - 700
LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLD    701 - 770
IEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE    771 - 840
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHT    841 - 910
SQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVN    911 - 980
DTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW                                        981 - 1014
//

Text Mined References (694)

PMID Year Title
27257257 2016 ADP-ribose-derived nuclear ATP synthesis by NUDIX5 is required for chromatin remodeling.
27256882 2016 Chemical genetic discovery of PARP targets reveals a role for PARP-1 in transcription elongation.
27067600 2016 HPF1/C4orf27 Is a PARP-1-Interacting Protein that Regulates PARP-1 ADP-Ribosylation Activity.
27055253 2016 Activation of the PI3K/mTOR Pathway following PARP Inhibition in Small Cell Lung Cancer.
26975633 2016 APR-246 (PRIMA-1(MET)) strongly synergizes with AZD2281 (olaparib) induced PARP inhibition to induce apoptosis in non-small cell lung cancer cell lines.
26920250 2016 Poly (ADP-ribose) polymerases inhibitor, Zj6413, as a potential therapeutic agent against breast cancer.
26895424 2016 PARP1 Links CHD2-Mediated Chromatin Expansion and H3.3 Deposition to DNA Repair by Non-homologous End-Joining.
26826460 2016 Decreased DNA repair gene XRCC1 expression is associated with radiotherapy-induced acute side effects in breast cancer patients.
26822515 2016 Poly(ADP-ribosyl)ation of Apoptosis Antagonizing Transcription Factor Involved in Hydroquinone-Induced DNA Damage Response.
26730949 2016 p21CDKN1A Regulates the Binding of Poly(ADP-Ribose) Polymerase-1 to DNA Repair Intermediates.
26673720 2016 Single molecule detection of PARP1 and PARP2 interaction with DNA strand breaks and their poly(ADP-ribosyl)ation using high-resolution AFM imaging.
26634655 2016 LRP1 Regulates Retinal Angiogenesis by Inhibiting PARP-1 Activity and Endothelial Cell Proliferation.
26626480 2015 PARP-1 Activation Requires Local Unfolding of an Autoinhibitory Domain.
26626479 2015 Structural Basis of Detection and Signaling of DNA Single-Strand Breaks by Human PARP-1.
26619102 2015 PARP-1 expression in CD34+ leukemic cells in childhood acute lymphoblastic leukemia: relation to response to initial therapy and other prognostic factors.
26603896 2016 DNA-PKcs and PARP1 Bind to Unresected Stalled DNA Replication Forks Where They Recruit XRCC1 to Mediate Repair.
26540566 2015 Tumor suppressive effect of PARP1 and FOXO3A in gastric cancers and its clinical implications.
26522181 2015 Doxorubicin-induced necrosis is mediated by poly-(ADP-ribose) polymerase 1 (PARP1) but is independent of p53.
26513298 2015 E7449: A dual inhibitor of PARP1/2 and tankyrase1/2 inhibits growth of DNA repair deficient tumors and antagonizes Wnt signaling.
26505995 2015 Combinations of PARP Inhibitors with Temozolomide Drive PARP1 Trapping and Apoptosis in Ewing's Sarcoma.
26429911 2015 Poly(ADP-ribosyl)ation of FOXP3 Protein Mediated by PARP-1 Protein Regulates the Function of Regulatory T Cells.
26424850 2016 Femtosecond near-infrared laser microirradiation reveals a crucial role for PARP signaling on factor assemblies at DNA damage sites.
26391948 2015 Differential and Concordant Roles for Poly(ADP-Ribose) Polymerase 1 and Poly(ADP-Ribose) in Regulating WRN and RECQL5 Activities.
26387143 2015 Negative prognostic value of high levels of intracellular poly(ADP-ribose) in non-small cell lung cancer.
26370511 2015 Global Transcriptome Analysis Reveals That Poly(ADP-Ribose) Polymerase 1 Regulates Gene Expression through EZH2.
26356822 2015 Small molecule inhibition of the CHFR-PARP1 interaction as novel approach to overcome intrinsic taxane resistance in cancer.
26351319 2015 Poly-ADP-Ribose Polymerase as a Therapeutic Target in Pediatric Diffuse Intrinsic Pontine Glioma and Pediatric High-Grade Astrocytoma.
26344098 2015 Timeless Interacts with PARP-1 to Promote Homologous Recombination Repair.
26321255 2015 PARP1- and CTCF-Mediated Interactions between Active and Repressed Chromatin at the Lamina Promote Oscillating Transcription.
26314963 2015 Inhibition of poly(ADP-ribose) polymerase 1 protects against acute myeloid leukemia by suppressing the myeloproliferative leukemia virus oncogene.
26305327 2015 Genome-Wide Profiling of PARP1 Reveals an Interplay with Gene Regulatory Regions and DNA Methylation.
26261599 2015 Polymorphisms in poly (ADP-ribose) polymerase-1 (PARP1) promoter and 3' untranslated region and their association with PARP1 expression in breast cancer patients.
26205779 2015 PARP is activated in human asthma and its inhibition by olaparib blocks house dust mite-induced disease in mice.
26183824 2015 Poly(ADP-ribose) polymerase as a novel regulator of 17?-estradiol-induced cell growth through a control of the estrogen receptor/IGF-1 receptor/PDZK1 axis.
26181362 2015 Poly(ADP-ribose)polymerase 1 stimulates the AP-site cleavage activity of tyrosyl-DNA phosphodiesterase 1.
26181065 2015 Pyrimidine Pool Disequilibrium Induced by a Cytidine Deaminase Deficiency Inhibits PARP-1 Activity, Leading to the Under Replication of DNA.
26170451 2015 Poly(ADP-ribose) Polymerase 1 Modulates Interaction of the Nucleotide Excision Repair Factor XPC-RAD23B with DNA via Poly(ADP-ribosyl)ation.
26157130 2015 Downregulation of Poly(ADP-Ribose) Polymerase 1 by a Viral Processivity Factor Facilitates Lytic Replication of Gammaherpesvirus.
26136340 2015 5mC-hydroxylase activity is influenced by the PARylation of TET1 enzyme.
26091342 2015 Structures and Mechanisms of Enzymes Employed in the Synthesis and Degradation of PARP-Dependent Protein ADP-Ribosylation.
26091341 2015 Chromatin to Clinic: The Molecular Rationale for PARP1 Inhibitor Function.
26091339 2015 PARPs and ADP-Ribosylation: 50 Years … and Counting.
26090615 2015 YM155, a survivin suppressant, triggers PARP-dependent cell death (parthanatos) and inhibits esophageal squamous-cell carcinoma xenografts in mice.
25998844 2015 Variants of Base Excision Repair Genes MUTYH , PARP1 and XRCC1 in Alzheimer's Disease Risk.
25992604 2015 Transcription of the Human Microsomal Epoxide Hydrolase Gene (EPHX1) Is Regulated by PARP-1 and Histone H1.2. Association with Sodium-Dependent Bile Acid Transport.
25981734 2015 Differential Potential of Pharmacological PARP Inhibitors for Inhibiting Cell Proliferation and Inducing Apoptosis in Human Breast Cancer Cells.
25940138 2015 Acyl-CoA-binding domain containing 3 modulates NAD+ metabolism through activating poly(ADP-ribose) polymerase 1.
25938539 2015 PARP inhibitor ABT-888 affects response of MDA-MB-231 cells to doxorubicin treatment, targeting Snail expression.
25916114 [Molecular mechanisms of regulaion of transcription by PARP1].
25883215 2015 Complementary genetic screens identify the E3 ubiquitin ligase CBLC, as a modifier of PARP inhibitor sensitivity.
25882840 2015 Nuclear-translocated Glyceraldehyde-3-phosphate Dehydrogenase Promotes Poly(ADP-ribose) Polymerase-1 Activation during Oxidative/Nitrosative Stress in Stroke.
25881554 2015 PARP-1 involvement in neurodegeneration: A focus on Alzheimer's and Parkinson's diseases.
25865228 2015 Autoimmune response to PARP and BRCA1/BRCA2 in cancer.
25837821 2015 Inherited genetic variants associated with occurrence of multiple primary melanoma.
25833211 2015 PARP1 and phospho-p65 protein expression is increased in human HER2-positive breast cancers.
25828893 2015 c-MYC Generates Repair Errors via Increased Transcription of Alternative-NHEJ Factors, LIG3 and PARP1, in Tyrosine Kinase-Activated Leukemias.
25818652 2015 The Streptococcus pyogenes?NAD(+) glycohydrolase modulates epithelial cell PARylation and HMGB1 release.
25808111 2015 Expression of nuclear matrix proteins binding matrix attachment regions in prostate cancer. PARP-1: New player in tumor progression.
25800440 2015 Quantitative site-specific ADP-ribosylation profiling of DNA-dependent PARPs.
25793984 2015 Low shear stress induced HMGB1 translocation and release via PECAM-1/PARP-1 pathway to induce inflammation response.
25779917 2015 Expression of human poly (ADP-ribose) polymerase 1 in Saccharomyces cerevisiae: Effect on survival, homologous recombination and identification of genes involved in intracellular localization.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25749521 2015 TNKS1BP1 functions in DNA double-strand break repair though facilitating DNA-PKcs autophosphorylation dependent on PARP-1.
25738796 2015 Downregulation of NIT2 inhibits colon cancer cell proliferation and induces cell cycle arrest through the caspase-3 and PARP pathways.
25733866 2015 Proteome-wide analysis of mutant p53 targets in breast cancer identifies new levels of gain-of-function that influence PARP, PCNA, and MCM4.
25722289 2015 SUMOylation and PARylation cooperate to recruit and stabilize SLX4 at DNA damage sites.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25634215 2015 A unique subset of epithelial ovarian cancers with platinum sensitivity and PARP inhibitor resistance.
25611238 2015 The prognostic and predictive significance of PARP-1 in locally advanced breast cancer of Egyptian patients receiving neoadjuvant chemotherapy.
25555679 2015 RecQ helicases and PARP1 team up in maintaining genome integrity.
25536389 2015 Effect of NAD on PARP-mediated insulin sensitivity in oleic acid treated hepatocytes.
25528020 2015 Biological and clinical significance of PARP1 protein expression in breast cancer.
25526641 2014 PARP-1 expression is increased in colon adenoma and carcinoma and correlates with OGG1.
25517228 2015 Poly(ADP-ribose) polymerase 1-sirtuin 1 functional interplay regulates LPS-mediated high mobility group box 1 secretion.
25483710 2015 BRCA1, PARP1 and ?H2AX in acute myeloid leukemia: Role as biomarkers of response to the PARP inhibitor olaparib.
25480692 2015 The nuclear expression of poly (ADP-ribose) polymerase-1 (PARP1) in invasive primary breast tumors is associated with chemotherapy sensitivity.
25400754 2014 Clinical significance of NQO1 polymorphism and expression of p53, SOD2, PARP1 in limited-stage small cell lung cancer.
25378300 2014 Opposing roles of mitochondrial and nuclear PARP1 in the regulation of mitochondrial and nuclear DNA integrity: implications for the regulation of mitochondrial function.
25337234 2014 Effect of adriamycin on BRCA1 and PARP-1 expression in MCF-7 breast cancer cells.
25333575 2014 Knockdown of glucose-regulated protein 78 enhances poly(ADP-ribose) polymerase cleavage in human pancreatic cancer cells exposed to endoplasmic reticulum stress.
25331333 2015 PARP1 polymorphisms play opposing roles in melanoma occurrence and survival.
25306110 2014 MacroH2A1.1 and PARP-1 cooperate to regulate transcription by promoting CBP-mediated H2B acetylation.
25278026 2014 The 3'-5' DNA exonuclease TREX1 directly interacts with poly(ADP-ribose) polymerase-1 (PARP1) during the DNA damage response.
25257171 2015 Regulation of E2F1-induced apoptosis by poly(ADP-ribosyl)ation.
25225750 2014 PARP-1 rs3219073 polymorphism may contribute to susceptibility to lung cancer.
25220464 2014 ARTD1/PARP1 negatively regulates glycolysis by inhibiting hexokinase 1 independent of NAD+ depletion.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25161998 2014 PARP1-driven apoptosis in chronic lymphocytic leukemia.
25136112 2014 Automodification switches PARP-1 function from chromatin architectural protein to histone chaperone.
25133494 2014 Fine-tuning of Smad protein function by poly(ADP-ribose) polymerases and poly(ADP-ribose) glycohydrolase during transforming growth factor ? signaling.
25128455 2014 Poly (ADP-ribose) polymerase inhibition enhances trastuzumab antitumour activity in HER2 overexpressing breast cancer.
25118896 2014 Poly(ADP-ribose) polymerase-1 (PARP1) and p53 labelling index correlates with tumour grade in meningiomas.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25106941 2014 Association of common SNP rs1136410 in PARP1 gene with the susceptibility to male infertility with oligospermia.
25103497 2014 TGF? induces "BRCAness" and sensitivity to PARP inhibition in breast cancer by regulating DNA-repair genes.
25052090 2014 PARP1-mediated necrosis is dependent on parallel JNK and Ca²?/calpain pathways.
25037599 2014 PARP-1 and CASP3 genes are up-regulated in LNCaP and PC-3 prostate cancer cell lines.
24970803 2014 Niraparib (MK-4827), a novel poly(ADP-Ribose) polymerase inhibitor, radiosensitizes human lung and breast cancer cells.
24956560 2014 Association of PARP-1, NF-?B, NF-?BIA and IL-6, IL-1? and TNF-? with Graves Disease and Graves Ophthalmopathy.
24953096 2014 Poly(ADP-ribose)-mediated interplay of XPA and PARP1 leads to reciprocal regulation of protein function.
24939750 2014 Poly(ADP-ribosyl)ation is involved in the epigenetic control of TET1 gene transcription.
24889936 2014 Parp-1 genetic ablation in Ela-myc mice unveils novel roles for Parp-1 in pancreatic cancer.
24874429 2014 Rapamycin-resistant poly (ADP-ribose) polymerase-1 overexpression is a potential therapeutic target in lymphangioleiomyomatosis.
24870775 2014 Novel mutations of the PARP-1 gene associated with colorectal cancer in the Saudi population.
24866151 2014 Vulnerabilities of PTEN-TP53-deficient prostate cancers to compound PARP-PI3K inhibition.
24856976 2014 B-lymphoblastic leukemia/lymphoma: overexpression of nuclear DNA repair protein PARP-1 correlates with antiapoptotic protein Bcl-2 and complex chromosomal abnormalities.
24853559 2014 PARP-1 Val762Ala polymorphism and risk of cancer: a meta-analysis based on 39 case-control studies.
24847116 2014 Targeting poly(ADP-ribose) polymerase and the c-Myb-regulated DNA damage response pathway in castration-resistant prostate cancer.
24843141 2014 Mechanisms controlling the smooth muscle cell death in progeria via down-regulation of poly(ADP-ribose) polymerase 1.
24832602 2014 ?-Lapachone induces programmed necrosis through the RIP1-PARP-AIF-dependent pathway in human hepatocellular carcinoma SK-Hep1 cells.
24829399 2014 Silencing of poly(ADP-ribose) polymerase-1 suppresses hyperstretch-induced expression of inflammatory cytokines in vitro.
24821649 2015 Synergistic cytotoxicity of the poly (ADP-ribose) polymerase inhibitor ABT-888 and temozolomide in dual-drug targeted magnetic nanoparticles.
24778456 2014 S-sulfhydration of MEK1 leads to PARP-1 activation and DNA damage repair.
24761869 2014 Expression of ERCC1, MSH2 and PARP1 in non-small cell lung cancer and prognostic value in patients treated with platinum-based chemotherapy.
24726141 2014 The histone methyltransferase SMYD2 methylates PARP1 and promotes poly(ADP-ribosyl)ation activity in cancer cells.
24684389 2014 Parthanatos: mitochondrial-linked mechanisms and therapeutic opportunities.
24636898 2014 p300 cooperates with c-Jun and PARP-1 at the p300 binding site to activate RhoB transcription in NSC126188-mediated apoptosis.
24595077 2013 Heterogeneous nuclear ribonucleoprotein U-like 1 and Poly (ADP-ribose) polymerase 1 are downregulated in renal cell carcinoma and connected with the prognosis.
24588584 2014 Conformational activation of poly(ADP-ribose) polymerase-1 upon DNA binding revealed by small-angle X-ray scattering.
24556618 2014 Tumour cell retention of rucaparib, sustained PARP inhibition and efficacy of weekly as well as daily schedules.
24550317 2014 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
24535833 2014 Inherited variation in the PARP1 gene and survival from melanoma.
24535158 2014 Nuclear-cytoplasmic PARP-1 expression as an unfavorable prognostic marker in lymph node?negative early breast cancer: 15-year follow-up.
24489833 2014 Association between the PARP1 Val762Ala polymorphism and cancer risk: evidence from 43 studies.
24448423 2014 Poly (ADP-ribose) polymerase 1 transcriptional regulation: a novel crosstalk between histone modification H3K9ac and ETS1 motif hypomethylation in BRCA1-mutated ovarian cancer.
24436031 2014 Expression of PARP-1 and its active polymer PAR in prostate cancer and benign prostatic hyperplasia in Chinese patients.
24392019 2013 Association between PARP-1 V762A polymorphism and breast cancer susceptibility in Saudi population.
24378347 2014 The CDK1 inhibitor RO3306 improves the response of BRCA-pro?cient breast cancer cells to PARP inhibition.
24356817 2014 Glioblastoma cells containing mutations in the cohesin component STAG2 are sensitive to PARP inhibition.
24356582 2013 Poly(ADP-ribose) binding to Chk1 at stalled replication forks is required for S-phase checkpoint activation.
24319532 2013 Accelerated aging during chronic oxidative stress: a role for PARP-1.
24289924 2014 Phosphorylation of p53 by TAF1 inactivates p53-dependent transcription in the DNA damage response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24275069 2014 Arsenite binding-induced zinc loss from PARP-1 is equivalent to zinc deficiency in reducing PARP-1 activity, leading to inhibition of DNA repair.
24270264 2014 Role for DNA damage signaling in pulmonary arterial hypertension.
24239883 2013 Inhibition of PARP1 by small interfering RNA enhances docetaxel activity against human prostate cancer PC3 cells.
24219164 2014 Effect of a poly(ADP-ribose) polymerase-1 inhibitor against esophageal squamous cell carcinoma cell lines.
24203816 2014 Two DNA repair gene polymorphisms on the risk of gastrointestinal cancers: a meta-analysis.
24197988 2014 Incidence and prognostic value of multiple gene promoter methylations in gliomas.
24191908 2013 BRCA1 promoter hypermethylation, 53BP1 protein expression and PARP-1 activity as biomarkers of DNA repair deficit in breast cancer.
24180296 2014 Investigation of poly (ADP-ribose) polymerase-1 genetic variants as a possible risk for allergic rhinitis.
24145797 2013 PARP1 orchestrates variant histone exchange in signal-mediated transcriptional activation.
24140708 2014 Poly(ADP-ribose) polymerase-1 modulates Nrf2-dependent transcription.
24088713 2013 SET7/9-dependent methylation of ARTD1 at K508 stimulates poly-ADP-ribose formation after oxidative stress.
24085845 2013 Stabilization of mutant BRCA1 protein confers PARP inhibitor and platinum resistance.
24079274 2013 Disaccharide pyrimidine nucleosides and their derivatives: a novel group of cell-penetrating inhibitors of poly(ADP-ribose) polymerase 1.
24055346 2013 The chromatin scaffold protein SAFB1 renders chromatin permissive for DNA damage signaling.
24043304 2013 Poly(ADP-ribose) polymerase 1 promotes oxidative-stress-induced liver cell death via suppressing farnesoid X receptor ?.
24038028 2014 Impact of promoter polymorphisms in key regulators of the intrinsic apoptosis pathway on the outcome of childhood acute lymphoblastic leukemia.
24013388 2013 Mycoplasma fermentans inhibits the activity of cellular DNA topoisomerase I by activation of PARP1 and alters the efficacy of its anti-cancer inhibitor.
23974709 2013 Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss.
23940283 2013 PARP-1 regulates expression of TGF-? receptors in T cells.
23939864 2013 Artd1/Parp1 regulates reprogramming by transcriptional regulation of Fgf4 via Sox2 ADP-ribosylation.
23926104 2013 Tripartite Motif-containing 33 (TRIM33) protein functions in the poly(ADP-ribose) polymerase (PARP)-dependent DNA damage response through interaction with Amplified in Liver Cancer 1 (ALC1) protein.
23923393 A novel class of substituted spiro [quinazoline-2,1'-cyclohexane] derivatives as effective PPAR-1 inhibitors: molecular modeling, synthesis, cytotoxic and enzyme assay evaluation.
23913164 2013 TDP1 and PARP1 deficiency are cytotoxic to rhabdomyosarcoma cells.
23910651 2013 Reduced ADP-ribosylation by PARP1 natural polymorphism V762A and by PARP1 inhibitors enhance Hepatitis B virus replication.
23883585 2013 Catalase abrogates ?-lapachone-induced PARP1 hyperactivation-directed programmed necrosis in NQO1-positive breast cancers.
23871147 2013 DNA-dependent SUMO modification of PARP-1.
23833192 2013 The RNA-binding protein fused in sarcoma (FUS) functions downstream of poly(ADP-ribose) polymerase (PARP) in response to DNA damage.
23807292 2013 Poly (ADP-ribose) polymerase 1 protein expression in normal and neoplastic prostatic tissue.
23803078 2013 The C allele of a synonymous SNP (rs1805414, Ala284Ala) in PARP1 is a risk factor for susceptibility to breast cancer in Saudi patients.
23785295 2013 PARP-1 regulates metastatic melanoma through modulation of vimentin-induced malignant transformation.
23775790 2013 DNA damage-induced inhibition of rRNA synthesis by DNA-PK and PARP-1.
23762867 2013 Hypomethylation of ETS transcription factor binding sites and upregulation of PARP1 expression in endometrial cancer.
23760440 2014 Association between the poly(ADP-ribose) polymerase-1 gene polymorphism and advanced pelvic organ prolapse.
23760205 2014 TNF-induced necroptosis and PARP-1-mediated necrosis represent distinct routes to programmed necrotic cell death.
23757351 2013 MicroRNA 223 is upregulated in the multistep progression of Barrett's esophagus and modulates sensitivity to chemotherapy by targeting PARP1.
23644255 2013 Effects of passive smoking on breast cancer risk in pre/post-menopausal women as modified by polymorphisms of PARP1 and ESR1.
23640560 2013 Effects of poly (ADP-ribosyl) polymerase (PARP) inhibitor on cisplatin resistance & proliferation of the ovarian cancer C13* cells.
23633189 2013 Involvement of PARP-1 Val762Ala polymorphism in the onset of cervical cancer in caucasian women.
23616419 2014 Caspase 3 activation and PARP cleavage in lymphocytes from newborn babies of diabetic mothers with unbalanced glycaemic control.
23608917 2013 Whole-exome sequencing and imaging genetics identify functional variants for rate of change in hippocampal volume in mild cognitive impairment.
23593027 2013 DNA double-strand breaks coupled with PARP1 and HNRNPA2B1 binding sites flank coordinately expressed domains in human chromosomes.
23577092 2013 The role of hnRPUL1 involved in DNA damage response is related to PARP1.
23576132 2013 Association of poly(ADP-ribose) polymerase-1 polymorphism with Tourette syndrome.
23574784 2013 Poly(adenosine diphosphate-ribose) polymerase expression in BRCA-proficient ovarian high-grade serous carcinoma; association with patient survival.
23568489 2013 PARP1 is required for chromosomal translocations.
23563481 2013 Poly(ADP-ribose) polymerase-1 regulates the mechanism of irradiation-induced CNE-2 human nasopharyngeal carcinoma cell autophagy and inhibition of autophagy contributes to the radiation sensitization of CNE-2 cells.
23554447 2013 Cisplatin resistance associated with PARP hyperactivation.
23548269 2013 ATR inhibition broadly sensitizes ovarian cancer cells to chemotherapy independent of BRCA status.
23537197 2013 Genetic variants in PARP1 (rs3219090) and IRF4 (rs12203592) genes associated with melanoma susceptibility in a Spanish population.
23510475 2013 Tocotrienols promote apoptosis in human breast cancer cells by inducing poly(ADP-ribose) polymerase cleavage and inhibiting nuclear factor kappa-B activity.
23486608 2013 PARP expression in germ cell tumours.
23481255 2013 Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease.
23479135 2013 Polymorphisms in the base excision repair pathway modulate prognosis of platinum-based chemotherapy in advanced non-small cell lung cancer.
23467693 2013 PARP1 gene expression is downregulated by knockdown of PARG gene.
23455322 2014 Interaction between PARP-1 and HIF-2? in the hypoxic response.
23438649 2013 Mapping PARP-1 auto-ADP-ribosylation sites by liquid chromatography-tandem mass spectrometry.
23430444 2013 Polymorphisms in genes of APE1, PARP1, and XRCC1: risk and prognosis of colorectal cancer in a northeast Chinese population.
23429506 2013 Peroxiredoxin 2 battles poly(ADP-ribose) polymerase 1- and p53-dependent prodeath pathways after ischemic injury.
23410825 2013 PARP1 impact on DNA repair of platinum adducts: preclinical and clinical read-outs.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23355608 2013 Distinct spatiotemporal patterns and PARP dependence of XRCC1 recruitment to single-strand break and base excision repair.
23319653 2013 Role of poly(ADP-ribose) polymerase-1 in the removal of UV-induced DNA lesions by nucleotide excision repair.
23317230 2012 Polymorphisms of XRCC1 and ADPRT genes and risk of noncardia gastric cancer in a Chinese population: a case-control study.
23301673 2013 PARP1 inhibition affects pleural mesothelioma cell viability and uncouples AKT/mTOR axis via SIRT1.
23275542 2013 2,3,7,8-Tetrachlorodibenzo-p-dioxin poly(ADP-ribose) polymerase (TiPARP, ARTD14) is a mono-ADP-ribosyltransferase and repressor of aryl hydrocarbon receptor transactivation.
23275151 2013 PARP inhibition selectively increases sensitivity to cisplatin in ERCC1-low non-small cell lung cancer cells.
23255787 2013 Poly(ADP-ribose) polymerase 1 promotes transcriptional repression of integrated retroviruses.
23254695 2013 Inhibition of poly(ADP-ribose) polymerase-1 or poly(ADP?ribose) glycohydrolase individually, but not in combination, leads to improved chemotherapeutic efficacy in HeLa cells.
23244082 2012 XRCC1 and ADPRT polymorphisms associated with survival in breast cancer cases treated with chemotherapy.
23230272 2013 BAL1 and its partner E3 ligase, BBAP, link Poly(ADP-ribose) activation, ubiquitylation, and double-strand DNA repair independent of ATM, MDC1, and RNF8.
23229555 2013 Apoptotic DNA fragmentation may be a cooperative activity between caspase-activated deoxyribonuclease and the poly(ADP-ribose) polymerase-regulated DNAS1L3, an endoplasmic reticulum-localized endonuclease that translocates to the nucleus during apoptosis.
23229313 2012 PARP and CSB modulate the processing of transcription-mediated DNA strand breaks.
23219533 2013 PARP1 represses PAP and inhibits polyadenylation during heat shock.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23132853 2012 Activation of the SNF2 family ATPase ALC1 by poly(ADP-ribose) in a stable ALC1·PARP1·nucleosome intermediate.
23110147 2012 PARP-1 modulation of mTOR signaling in response to a DNA alkylating agent.
23104860 2012 Coordination of DNA repair by NEIL1 and PARP-1: a possible link to aging.
23085506 2013 Poly(ADP-ribose) polymerase 1 inhibition protects against low shear stress induced inflammation.
23073772 2012 Racial and tissue-specific cancer risk associated with PARP1 (ADPRT) Val762Ala polymorphism: a meta-analysis.
23049934 2012 Inhibition of poly(ADP-ribose) polymerase interferes with Trypanosoma cruzi infection and proliferation of the parasite.
23045548 2012 PARP1 promotes nucleotide excision repair through DDB2 stabilization and recruitment of ALC1.
23040216 2012 Relationship between NADPH oxidase p22phox C242T, PARP-1 Val762Ala polymorphisms, angiographically verified coronary artery disease and myocardial infarction in South Indian patients with type 2 diabetes mellitus.
23038248 2012 Poly(ADP-ribose) contributes to an association between poly(ADP-ribose) polymerase-1 and xeroderma pigmentosum complementation group A in nucleotide excision repair.
23031826 2012 The histone variant macroH2A1.1 is recruited to DSBs through a mechanism involving PARP1.
23027378 2012 Poly(ADP-ribose) polymerase 1 inhibition protects human aortic endothelial cells against LPS-induced inflammation response.
23020228 2012 Cochinchina momordica seed extract induces apoptosis and cell cycle arrest in human gastric cancer cells via PARP and p53 signal pathways.
22993403 2012 Dual roles of PARP-1 promote cancer growth and progression.
22983827 2013 Association between polymorphisms of XRCC1 and ADPRT genes and ovarian cancer survival with platinum-based chemotherapy in Chinese population.
22982218 2013 The PARP inhibitor PJ34 modifies proliferation, NIS expression and epigenetic marks in thyroid cancer cell lines.
22948662 2012 CDK2-dependent activation of PARP-1 is required for hormonal gene regulation in breast cancer cells.
22926545 2013 Daidzein induced apoptosis via down-regulation of Bcl-2/Bax and triggering of the mitochondrial pathway in BGC-823 cells.
22880082 2012 The guanine-quadruplex structure in the human c-myc gene's promoter is converted into B-DNA form by the human poly(ADP-ribose)polymerase-1.
22864776 2012 Colorectal cancers differ in respect of PARP-1 protein expression.
22863007 2012 Exome capture reveals ZNF423 and CEP164 mutations, linking renal ciliopathies to DNA damage response signaling.
22854955 2012 Alternative modes of binding of poly(ADP-ribose) polymerase 1 to free DNA and nucleosomes.
22844406 2012 ADP ribosylation by PARP-1 suppresses HOXB7 transcriptional activity.
22820184 2012 Cloning and characterization of the human SH3BP2 promoter.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22753495 2012 Sirtuin 6 (SIRT6) rescues the decline of homologous recombination repair during replicative senescence.
22683995 2012 The zinc-finger domains of PARP1 cooperate to recognize DNA strand breaks.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22660976 2012 The role of PARP1 in the DNA damage response and its application in tumor therapy.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22634764 2012 Activation of the carbon concentrating mechanism by CO2 deprivation coincides with massive transcriptional restructuring in Chlamydomonas reinhardtii.
22624032 2012 PARP-1 Val762Ala polymorphism is associated with risk of cervical carcinoma.
22586318 2011 Stumbling blocks on the path to personalized medicine in breast cancer: the case of PARP inhibitors for BRCA1/2-associated cancers.
22582261 2012 Structural basis for DNA damage-dependent poly(ADP-ribosyl)ation by human PARP-1.
22550344 2012 Monocytic AML cells inactivate antileukemic lymphocytes: role of NADPH oxidase/gp91(phox) expression and the PARP-1/PAR pathway of apoptosis.
22542292 2012 RECQ1 plays a distinct role in cellular response to oxidative DNA damage.
22472897 2012 PARP-1 protein expression in glioblastoma multiforme.
22454210 2012 Expression of BAG-1 and PARP-1 in precursor lesions and invasive cervical cancer associated with human papillomavirus (HPV).
22451931 2012 Caspase-7 uses an exosite to promote poly(ADP ribose) polymerase 1 proteolysis.
22450322 2012 Increased transcript level of poly(ADP-ribose) polymerase (PARP-1) in human tricuspid compared with bicuspid aortic valves correlates with the stenosis severity.
22447567 2012 Mre11-dependent degradation of stalled DNA replication forks is prevented by BRCA2 and PARP1.
22392482 2012 Synthetic lethality of PARP inhibition in BRCA-network disrupted tumor cells is associated with interferon pathway activation and enhanced by interferon-?.
22387748 2012 Poly(ADP-ribose) polymerase-1 inhibition by arsenite promotes the survival of cells with unrepaired DNA lesions induced by UV exposure.
22384823 2012 High nuclear poly-(ADP-ribose)-polymerase expression is prognostic of improved survival in pancreatic cancer.
22344029 2012 A genome-wide homologous recombination screen identifies the RNA-binding protein RBMX as a component of the DNA-damage response.
22337872 2012 CHFR protein regulates mitotic checkpoint by targeting PARP-1 protein for ubiquitination and degradation.
22334709 2012 Regulation of poly(ADP-ribose) polymerase-1-dependent gene expression through promoter-directed recruitment of a nuclear NAD+ synthase.
22227934 2011 Differential expression of PARP1 mRNA in leucocytes of patients with Down's syndrome.
22221038 2012 PARP1 polymorphisms increase the risk of gastric cancer in a Chinese population.
22198485 2012 Cellular bioenergetics is regulated by PARP1 under resting conditions and during oxidative stress.
22193445 2011 [Suppressing poly(ADP-ribose)polymerase-1 inhibits tau phosphorylation in HEK293/tau441 cells].
22166496 2012 The role of microRNA-binding site polymorphisms in DNA repair genes as risk factors for bladder cancer and breast cancer and their impact on radiotherapy outcomes.
22158865 2012 Enhanced killing of cancer cells by poly(ADP-ribose) polymerase inhibitors and topoisomerase I inhibitors reflects poisoning of both enzymes.
22153339 2012 Novel poly(ADP-ribose) polymerase-1 inhibitors.
22134241 2011 Selective radiosensitization of p53 mutant pancreatic cancer cells by combined inhibition of Chk1 and PARP1.
22127734 2012 Association between PARP-1 V762A polymorphism and cancer susceptibility: a meta-analysis.
22120020 2012 A subset of chronic lymphocytic leukemia patients display reduced levels of PARP1 expression coupled with a defective irradiation-induced apoptosis.
22101337 2011 Poly(ADP-ribose) polymerase inhibition enhances p53-dependent and -independent DNA damage responses induced by DNA damaging agent.
22057269 2011 Poly(ADP-ribose) polymerase 1 (PARP-1) binds to 8-oxoguanine-DNA glycosylase (OGG1).
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
21997878 2011 Fibroblast growth factor regulates human neuroectoderm specification through ERK1/2-PARP-1 pathway.
21986234 2012 Two proapoptotic genes are downregulated in a patient with melanoma and repeated in-transit metastases.
21983785 2011 Genome-wide association study identifies a new melanoma susceptibility locus at 1q21.3.
21976405 2011 Constitutive abnormal expression of RasGRP-1 isoforms and low expression of PARP-1 in patients with systemic lupus erythematosus.
21945626 2011 PARP-1 enhances the mismatch-dependence of 5'-directed excision in human mismatch repair in vitro.
21915713 2011 Suppression of matrix metalloproteinase-9 expression in undifferentiated, non-apoptotic keratinocytes is abrogated by the cleavage of poly(ADP-ribose) polymerase-1.
21908496 2012 Nuclear PARP-1 protein overexpression is associated with poor overall survival in early breast cancer.
21858164 2011 Condensin I recruitment to base damage-enriched DNA lesions is modulated by PARP1.
21849329 2011 Pediatric high-grade glioma: identification of poly(ADP-ribose) polymerase as a potential therapeutic target.
21799911 2011 Ubiquitin ligase RNF146 regulates tankyrase and Axin to promote Wnt signaling.
21775006 2011 Impact of PARP-1 and DNA-PK expression on survival in patients with glioblastoma multiforme.
21767974 2011 Association analysis of PARP1 polymorphisms with Parkinson's disease.
21756783 2011 [Role of poly (ADP-ribose) polymerase 1 on DNA methylation variation induced by B(a)P in human bronchial epithelial cell].
21730054 2011 Involvement of protein kinase Cdelta/extracellular signal-regulated kinase/poly(ADP-ribose) polymerase-1 (PARP-1) signaling pathway in histamine-induced up-regulation of histamine H1 receptor gene expression in HeLa cells.
21729562 2011 [Effect of erythropoietin on proinflammatory factors of human monocytes and its mechanisms].
21680843 2011 SIRT6 promotes DNA repair under stress by activating PARP1.
21674737 2011 Effect of poly(ADP-ribose) polymerase 1 on integration of the adeno-associated viral vector genome.
21646373 2011 Senescent cells develop a PARP-1 and nuclear factor-{kappa}B-associated secretome (PNAS).
21644054 2013 PARP1 and CASP3 gene expression in a patient with multiple head and neck squamous cell carcinoma and Parkinson disease.
21612407 2011 Lymph node metastasis of gastric cancer is associated with the interaction between poly (ADP-ribose) polymerase 1 and matrix metallopeptidase 2.
21607289 Cordycepin blocks lung injury-associated inflammation and promotes BRCA1-deficient breast cancer cell killing by effectively inhibiting PARP.
21605336 2011 Vascular endothelial growth factor confers endothelial resistance to apoptosis through poly(ADP-ribose) polymerase.
21577210 2011 Poly(ADP-ribose)-dependent regulation of Snail1 protein stability.
21575865 2011 Mechanistic rationale for inhibition of poly(ADP-ribose) polymerase in ETS gene fusion-positive prostate cancer.
21568846 2011 Interaction of poly(ADP-ribose) polymerase 1 with apurinic/apyrimidinic sites within clustered DNA damage.
21555554 2011 Mild hyperthermia inhibits homologous recombination, induces BRCA2 degradation, and sensitizes cancer cells to poly (ADP-ribose) polymerase-1 inhibition.
21549307 2011 Maintenance of silent chromatin through replication requires SWI/SNF-like chromatin remodeler SMARCAD1.
21547351 2011 Over expression of LDOC1 and PARP1, two pro-apoptotic genes, in a patient with cryptorchidism and DiGeorge anomaly.
21532888 2011 p38? mitogen-activated protein kinase contributes to oncogenic properties maintenance and resistance to poly (ADP-ribose)-polymerase-1 inhibition in breast cancer.
21518760 2011 Identification of poly (ADP-ribose) polymerase-1 (PARP-1) as a novel Kruppel-like factor 8-interacting and -regulating protein.
21489980 2011 Thrombomodulin is silenced in malignant mesothelioma by a poly(ADP-ribose) polymerase-1-mediated epigenetic mechanism.
21487248 2011 Synthetic lethality of PARP inhibition in cancers lacking BRCA1 and BRCA2 mutations.
21476963 2011 Poly (ADP-ribose) polymerase-1 (PARP-1) as immune regulator.
21469519 2011 PARP-1 activity in normal and cancerous human endometrium and its relationship with quantity of abasic sites (AP).
21460625 2011 PARP and RIP 1 are required for autophagy induced by 11'-deoxyverticillin A, which precedes caspase-dependent apoptosis.
21447796 2011 MYC, PARP1, and chemoresistance: BIN there, done that?
21434873 2011 Poly(ADP-ribose) polymerase-1 (PARP-1) pharmacogenetics, activity and expression analysis in cancer patients and healthy volunteers.
21424107 2011 Poly(ADP-ribose) polymerase-1 inhibition: preclinical and clinical development of synthetic lethality.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21293287 2011 Expression of poly (adenosine diphosphate-ribose) polymerase and p53 in epithelial ovarian cancer and their role in prognosis and disease outcome.
21269460 2011 Initial characterization of the human central proteome.
21266351 2011 hPuf-A/KIAA0020 modulates PARP-1 cleavage upon genotoxic stress.
21256093 2011 Competition between PARP-1 and Ku70 control the decision between high-fidelity and mutagenic DNA repair.
21224467 2011 Notch/HES1-mediated PARP1 activation: a cell type-specific mechanism for tumor suppression.
21187397 2011 Nanoparticle-mediated delivery of siRNA targeting Parp1 extends survival of mice bearing tumors derived from Brca1-deficient ovarian cancer cells.
21183686 2011 Double-stranded DNA binding domain of poly(ADP-ribose) polymerase-1 and molecular insight into the regulation of its activity.
21127267 2010 Apurinic/apyrimidinic (AP) site recognition by the 5'-dRP/AP lyase in poly(ADP-ribose) polymerase-1 (PARP-1).
21095583 2010 PARP-1 attenuates Smad-mediated transcription.
21037106 2010 Polymorphisms in base excision repair genes as colorectal cancer risk factors and modifiers of the effect of diets high in red meat.
21031461 2011 Poly(ADP-ribose) polymerase 1 is involved in glucose toxicity through SIRT1 modulation in HepG2 hepatocytes.
20977936 2011 Age-related loss of stress-induced nuclear proteasome activation is due to low PARP-1 activity.
20967817 2010 Bioorthogonal small-molecule ligands for PARP1 imaging in living cells.
20953586 2011 PARP-1 expression and activity in primary human lung cells.
20950443 2010 The multikinase inhibitor Sorafenib displays significant antiproliferative effects and induces apoptosis via caspase 3, 7 and PARP in B- and T-lymphoblastic cells.
20940411 2010 Prostate cancer radiosensitization through poly(ADP-Ribose) polymerase-1 hyperactivation.
20876582 2010 Poly(ADP-ribose) polymerase-1 (PARP-1) contributes to the barrier function of a vertebrate chromatin insulator.
20875401 2011 Poly(ADP-ribose) polymerase signaling of topoisomerase 1-dependent DNA damage in carcinoma cells.
20868244 2010 Glioma risk associates with polymorphisms of DNA repair genes, XRCC1 and PARP1.
20837404 2011 Genetic variation in DNA repair pathway genes and melanoma risk.
20832725 2010 PARP-1 regulates chromatin structure and transcription through a KDM5B-dependent pathway.
20823142 2010 Poly (ADP-ribose) polymerase as a novel therapeutic target in cancer.
20817730 2010 Cooperative role of NF-{kappa}B and poly(ADP-ribose) polymerase 1 (PARP-1) in the TNF-induced inhibition of PHEX expression in osteoblasts.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20711239 2010 C-terminal binding protein and poly(ADP)ribose polymerase 1 contribute to repression of the p21(waf1/cip1) promoter.
20665026 2012 Lack of association between poly(ADP-ribose) polymerase (PARP) polymorphisms and rheumatoid arthritis in a Korean population.
20652015 2010 The BRCT domain of PARP-1 is required for immunoglobulin gene conversion.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20629644 2010 Effects of varicocele upon the expression of apoptosis-related proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619687 iNOS induction and PARP-1 activation in human atherosclerotic lesions: an immunohistochemical and ultrastructural approach.
20603072 2010 The PARP side of the nucleus: molecular actions, physiological outcomes, and clinical targets.
20587588 2010 Comprehensive analysis of the palindromic motif TCTCGCGAGA: a regulatory element of the HNRNPK promoter.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
20573551 2010 Alkylation DNA damage in combination with PARP inhibition results in formation of S-phase-dependent double-strand breaks.
20564216 2010 Poly (ADP-ribose) polymerase-1 binds to BCL2 major breakpoint region and regulates BCL2 expression.
20561897 2010 Inflammatory and age-related pathologies in mice with ectopic expression of human PARP-1.
20559012 2009 Polyunsaturated fatty acids, DNA repair single nucleotide polymorphisms and colorectal cancer in the Singapore Chinese Health Study.
20550106 2010 Recognition of platinum-DNA damage by poly(ADP-ribose) polymerase-1.
20544540 2010 PARP activity and NAD concentration in PMC from patients affected by systemic sclerosis and lupus erythematosus.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20514865 Poly(ADP-ribose) polymerase 1 interaction with apurinic/apyrimidinic sites.
20495366 2010 Genetic polymorphisms in XRCC1 associated with radiation therapy in prostate cancer.
20493910 2010 Characterization of nuclear factors modulating the apolipoprotein D promoter during growth arrest: implication of PARP-1, APEX-1 and ERK1/2 catalytic activities.
20493163 2010 Cigarette smoke-induced autophagy is regulated by SIRT1-PARP-1-dependent mechanism: implication in pathogenesis of COPD.
20486200 2010 Evaluation of the poly(ADP-ribose) polymerase-1 gene variants in Alzheimer's disease.
20473728 2010 Triple-negative breast cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20399804 2010 Enzyme characteristics of recombinant poly(ADP-ribose) polymerases-1 of rat and human origin mirror the correlation between cellular poly(ADP-ribosyl)ation capacity and species-specific life span.
20388712 2010 The Zn3 domain of human poly(ADP-ribose) polymerase-1 (PARP-1) functions in both DNA-dependent poly(ADP-ribose) synthesis activity and chromatin compaction.
20373286 2010 Aurora-A expressing tumour cells are deficient for homology-directed DNA double strand-break repair and sensitive to PARP inhibition.
20353610 2010 Association analysis of ADPRT1, AKR1B1, RAGE, GFPT2 and PAI-1 gene polymorphisms with chronic renal insufficiency among Asian Indians with type-2 diabetes.
20232390 2011 Genetic variations of DNA repair genes and their prognostic significance in patients with acute myeloid leukemia.
20223788 2010 Genetic polymorphisms of DNA repair genes and chromosomal damage in workers exposed to 1,3-butadiene.
20219917 2010 Regulation of Epstein-Barr virus OriP replication by poly(ADP-ribose) polymerase 1.
20218899 2010 Genetic variants of XRCC1, APE1, and ADPRT genes and risk of bladder cancer.
20196871 2010 PARP-1 Val762Ala polymorphism is associated with reduced risk of non-Hodgkin lymphoma in Korean males.
20181890 2010 The septic shock-associated IL-10 -1082 A > G polymorphism mediates allele-specific transcription via poly(ADP-Ribose) polymerase 1 in macrophages engulfing apoptotic cells.
20177052 2010 Poly(ADP-ribose) polymerase (PARP)-1-independent apoptosis-inducing factor (AIF) release and cell death are induced by eleostearic acid and blocked by alpha-tocopherol and MEK inhibition.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20145242 2010 Trypanosoma cruzi induces the reactive oxygen species-PARP-1-RelA pathway for up-regulation of cytokine expression in cardiomyocytes.
20137830 2011 Telomere shortening is associated to TRF1 and PARP1 overexpression in Duchenne muscular dystrophy.
20124459 2010 ATM deficiency sensitizes mantle cell lymphoma cells to poly(ADP-ribose) polymerase-1 inhibitors.
20113831 2010 Analysis of poly(ADP-ribose) polymerase-1 (PARP1) gene alteration in human germ cell tumor cell lines.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
20072652 2010 A novel small molecule, LLL12, inhibits STAT3 phosphorylation and activities and exhibits potent growth-suppressive activity in human cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068062 2010 Constitutive activation of caspase-3 and Poly ADP ribose polymerase cleavage in fanconi anemia cells.
20064938 2010 PARP-3 is a mono-ADP-ribosylase that activates PARP-1 in the absence of DNA.
20060806 2010 PARP-1 inhibition does not restore oxidant-mediated reduction in SIRT1 activity.
20025963 2010 Chromatin repair after oxidative stress: role of PARP-mediated proteasome activation.
20016407 2010 Polymorphisms in PARP, IL1B, IL4, IL10, C1INH, DEFB1, and DEFA4 in meningococcal disease in three populations.
19996272 2009 BMS-754807, a small molecule inhibitor of insulin-like growth factor-1R/IR.
19962992 2010 Structural and biophysical studies of human PARP-1 in complex with damaged DNA.
19961617 2009 Potential biological role of poly (ADP-ribose) polymerase (PARP) in male gametes.
19946888 2010 Defining the membrane proteome of NK cells.
19925161 2010 Influence of PARP-1 polymorphisms in patients after traumatic brain injury.
19916945 2009 Interaction of DNA topoisomerase 1 with DNA intermediates and proteins of base excision repair.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19897724 2009 Activation of the abundant nuclear factor poly(ADP-ribose) polymerase-1 by Helicobacter pylori.
19877712 2009 Studies of the expression of human poly(ADP-ribose) polymerase-1 in Saccharomyces cerevisiae and identification of PARP-1 substrates by yeast proteome microarray screening.
19863315 2009 Poly(ADP-ribose) polymerase-1 (PARP-1) longer alleles spanning the promoter region may confer protection to bilateral Meniere's disease.
19812418 2009 Global analysis of transcriptional regulation by poly(ADP-ribose) polymerase-1 and poly(ADP-ribose) glycohydrolase in MCF-7 human breast cancer cells.
19809895 2010 The topical antimicrobial zinc pyrithione is a heat shock response inducer that causes DNA damage and PARP-dependent energy crisis in human skin cells.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19784808 2009 Doxorubicin-mediated apoptosis in glioma cells requires NFAT3.
19784367 2009 Poly[ADP-ribose] polymerase-1 expression is related to cold ischemia, acute tubular necrosis, and delayed renal function in kidney transplantation.
19779455 2009 PARP-1 transcriptional activity is regulated by sumoylation upon heat shock.
19723035 2009 Distribution of centromeric proteins and PARP-1 during mitosis and apoptosis.
19711368 2009 Critical role of poly(ADP-ribose) polymerase-1 in modulating the mode of cell death caused by continuous oxidative stress.
19703477 2010 Poly(ADP-ribose) polymerase 1 regulates activity of DNA polymerase beta in long patch base excision repair.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19684606 2009 Toll-like receptor 2 and poly(ADP-ribose) polymerase 1 promote central nervous system neuroinflammation in progressive EAE.
19680243 2009 A macrodomain-containing histone rearranges chromatin upon sensing PARP1 activation.
19666485 2009 Poly(ADP-ribosyl)ation directs recruitment and activation of an ATP-dependent chromatin remodeler.
19661379 2009 Poly(ADP-ribose)-dependent regulation of DNA repair by the chromatin remodeling enzyme ALC1.
19655414 2009 The augmented anti-tumor effects of Antrodia camphorata co-fermented with Chinese medicinal herb in human hepatoma cells.
19643912 2009 Aprataxin, poly-ADP ribose polymerase 1 (PARP-1) and apurinic endonuclease 1 (APE1) function together to protect the genome against oxidative damage.
19636556 2010 In vitro evaluation of pan-PI3-kinase inhibitor SF1126 in trastuzumab-sensitive and trastuzumab-resistant HER2-over-expressing breast cancer cells.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19607827 2009 Parp2 is required for the differentiation of post-meiotic germ cells: identification of a spermatid-specific complex containing Parp1, Parp2, TP2 and HSPA2.
19604089 2009 Pharmacodynamic genes do not influence risk of neutropenia in cancer patients treated with moderately high-dose irinotecan.
19585117 2010 Synergistic effect of 5-fluorouracil and the flavanoid oroxylin A on HepG2 human hepatocellular carcinoma and on H22 transplanted mice.
19568233 2009 Poly(ADP-ribose) polymerase-1 polymorphisms, expression and activity in selected human tumour cell lines.
19553815 2009 Promising molecular targets in ovarian cancer.
19544333 2010 Inositol hexaphosphate downregulates both constitutive and ligand-induced mitogenic and cell survival signaling, and causes caspase-mediated apoptotic death of human prostate carcinoma PC-3 cells.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19529948 2009 Neuronal caspase-3 and PARP-1 correlate differentially with apoptosis and necrosis in ischemic human stroke.
19515826 2009 Interaction of Sindbis virus non-structural protein 3 with poly(ADP-ribose) polymerase 1 in neuronal cells.
19513550 2009 gammaH2AX and cleaved PARP-1 as apoptotic markers in irradiated breast cancer BT474 cellular spheroids.
19506301 2009 The cytotoxic T lymphocyte protease granzyme A cleaves and inactivates poly(adenosine 5'-diphosphate-ribose) polymerase-1.
19484672 2009 The Ala allele at Val762Ala polymorphism in poly(ADP-ribose) polymerase-1 (PARP-1) gene is associated with a decreased risk of asthma in a Turkish population.
19470756 2009 SIRT1 promotes cell survival under stress by deacetylation-dependent deactivation of poly(ADP-ribose) polymerase 1.
19447888 2009 Positive transcriptional regulation of the human micro opioid receptor gene by poly(ADP-ribose) polymerase-1 and increase of its DNA binding affinity based on polymorphism of G-172 -> T.
19372636 2009 Autoantibodies to poly(ADP-ribose) polymerase in centenarians: a reappraisal of Grabar's hypothesis.
19369898 2009 Micronucleus occurrence related to base excision repair gene polymorphisms in Chinese workers occupationally exposed to vinyl chloride monomer.
19368128 Adenovirus-mediated thymidine kinase gene therapy induces apoptosis in human epithelial ovarian cancer cells and damages PARP-1.
19344625 2009 Poly(ADP-ribose) polymerase-1 (PARP-1) transcriptionally regulates angiotensin AT2 receptor (AT2R) and AT2R binding protein (ATBP) genes.
19303849 2009 A role of DNA-PK for the metabolic gene regulation in response to insulin.
19281796 2009 Regulation of FOXO1-mediated transcription and cell proliferation by PARP-1.
19247804 2009 Effect of PARP-1 deficiency on DNA damage and repair in human bronchial epithelial cells exposed to Benzo(a)pyrene.
19181665 2009 Poly(ADP-ribose) Polymerase 1 Interacts with Nuclear Respiratory Factor 1 (NRF-1) and Plays a Role in NRF-1 Transcriptional Regulation.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19147860 2009 Association between genetic polymorphisms of DNA base excision repair genes and evolution of precancerous gastric lesions in a Chinese population.
19144573 2009 Delocalization of nucleolar poly(ADP-ribose) polymerase-1 to the nucleoplasm and its novel link to cellular sensitivity to DNA damage.
19139632 2009 To die or to live: the dual role of poly(ADP-ribose) polymerase-1 in autophagy and necrosis under oxidative stress and DNA damage.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19124499 2009 Association and interactions between DNA repair gene polymorphisms and adult glioma.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19109787 2009 Polymorphisms of DNA repair genes: ADPRT, XRCC1, and XPD and cancer risk in genetic epidemiology.
19103807 2008 PARP-1 ensures regulation of replication fork progression by homologous recombination on damaged DNA.
19087198 2009 Post-ischemic brain damage: targeting PARP-1 within the ischemic neurovascular units as a realistic avenue to stroke treatment.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19060926 2009 Ionizing radiation-induced NF-kappaB activation requires PARP-1 function to confer radioresistance.
19056730 2009 Inhibition of poly(ADP-ribose) polymerase-1 by arsenite interferes with repair of oxidative DNA damage.
19030862 2009 The Val762Ala polymorphism in the poly(ADP-ribose) polymerase-1 gene is not associated with susceptibility in Turkish rheumatoid arthritis patients.
19029194 2009 Base excision repair genes and risk of lung cancer among San Francisco Bay Area Latinos and African-Americans.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
18996291 2008 Activation and overexpression of PARP-1 in circulating mononuclear cells promote TNF-alpha and IL-6 expression in patients with unstable angina.
18990703 2008 Poly(ADP-ribose) polymerase-1 down-regulates BRCA2 expression through the BRCA2 promoter.
18971944 2008 Chk2-dependent phosphorylation of XRCC1 in the DNA damage response promotes base excision repair.
18954712 2008 Replication-dependent radiosensitization of human glioma cells by inhibition of poly(ADP-Ribose) polymerase: mechanisms and therapeutic potential.
18779313 2008 Association between polymorphisms in DNA base excision repair genes XRCC1, APE1, and ADPRT and differentiated thyroid carcinoma.
18773488 2008 Integrin-linked kinase regulates E-cadherin expression through PARP-1.
18768662 2008 Poly(ADP-ribose) polymerase 1 binds to Pax8 and inhibits its transcriptional activity.
18752052 2009 Poly(adenosine diphosphate-ribose) polymerase-1 expression in cutaneous malignant melanomas as a new molecular marker of aggressive tumor.
18716896 2009 PARP-1 Val762Ala polymorphism, CagA+ H. pylori infection and risk for gastric cancer in Han Chinese population.
18695944 2009 Induction of apoptosis by the inhibitors of poly(ADP-ribose)polymerase in HeLa cells.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18676402 2008 Vitamin A depletion causes oxidative stress, mitochondrial dysfunction, and PARP-1-dependent energy deprivation.
18676401 2008 The histone subcode: poly(ADP-ribose) polymerase-1 (Parp-1) and Parp-2 control cell differentiation by regulating the transcriptional intermediary factor TIF1beta and the heterochromatin protein HP1alpha.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18663363 2008 Poly(ADP-ribosyl)ation is implicated in the G0-G1 transition of resting cells.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18619636 2008 Low concentration of arsenite exacerbates UVR-induced DNA strand breaks by inhibiting PARP-1 activity.
18599483 2008 The Poly(ADP-ribose) polymerase PARP-1 is required for oxidative stress-induced TRPM2 activation in lymphocytes.
18587655 2009 Role of PARP-1 and PARP-2 in the expression of apoptosis-regulating genes in HeLa cells.
18506195 2008 Quantification of poly(ADP-ribose)-modified proteins in cerebrospinal fluid from infants and children after traumatic brain injury.
18483312 2008 Ethnic disparities in Americans of European descent versus Americans of African descent related to polymorphic ERCC1, ERCC2, XRCC1, and PARP1.
18452307 2008 Domain C of human poly(ADP-ribose) polymerase-1 is important for enzyme activity and contains a novel zinc-ribbon motif.
18445785 2008 The complex of TFII-I, PARP1, and SFPQ proteins regulates the DYX1C1 gene implicated in neuronal migration and dyslexia.
18439038 2008 Repair of radiation-induced heat-labile sites is independent of DNA-PKcs, XRCC1 and PARP.
18376143 2008 Poly (ADP-ribose) polymerase activity regulates apoptosis in HeLa cells after alkylating DNA damage.
18357393 2008 Prevalence of BER gene polymorphisms in sporadic breast cancer.
18347181 2008 Irinotecan pharmacogenetics: influence of pharmacodynamic genes.
18339380 2009 Determination of Poly (ADP-ribose) polymerase (PARP) homologues in human ejaculated sperm and its correlation with sperm maturation.
18338862 2008 First evidence of a functional interaction between DNA quadruplexes and poly(ADP-ribose) polymerase-1.
18330920 2008 Discovery of genetic profiles impacting response to chemotherapy: application to gemcitabine.
18314489 2008 Poly(ADP-ribose) polymerase 1 promotes tumor cell survival by coactivating hypoxia-inducible factor-1-dependent gene expression.
18312852 2008 Upregulation of PEDF expression by PARP inhibition contributes to the decrease in hyperglycemia-induced apoptosis in HUVECs.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18279607 2008 [Expression and implication of base excision repair genes in human nasopharyngeal carcinoma and non-tumor nasopharyngeal tissues].
18258916 2008 Reciprocal binding of PARP-1 and histone H1 at promoters specifies transcriptional outcomes.
18230337 2008 p53-, SIRT1-, and PARP-1-independent downregulation of p21WAF1 expression in nicotinamide-treated cells.
18172500 2008 Poly(ADP-ribose)-binding zinc finger motifs in DNA repair/checkpoint proteins.
18164959 2008 Resveratrol-induced apoptosis in human breast cancer cells is mediated primarily through the caspase-3-dependent pathway.
18078995 2008 Regulation of NFAT by poly(ADP-ribose) polymerase activity in T cells.
18073140 2008 Identification of poly(ADP-ribose) polymerase-1 as the OXPHOS-generated ATP sensor of nuclei of animal cells.
18055453 2008 A third zinc-binding domain of human poly(ADP-ribose) polymerase-1 coordinates DNA-dependent enzyme activation.
18054777 2008 Effect of double-strand break DNA sequence on the PARP-1 NHEJ pathway.
18054108 2008 Leu54Phe and Val762Ala polymorphisms in the poly(ADP-ribose)polymerase-1 gene are associated with diabetic polyneuropathy in Russian type 1 diabetic patients.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18025084 2008 PARP1-dependent kinetics of recruitment of MRE11 and NBS1 proteins to multiple DNA damage sites.
18006925 2007 DNA repair single-nucleotide polymorphisms in colorectal cancer and their role as modifiers of the effect of cigarette smoking and alcohol in the Singapore Chinese Health Study.
17975135 2007 Targeting poly(ADP-ribose) polymerase: a two-armed strategy for cancer therapy.
17943227 2007 Genetic sequence variations and ADPRT haplotype analysis in French Canadian families with high risk of breast cancer.
17908769 2007 Genetic polymorphisms in immunoresponse genes TNFA, IL6, IL10, and TLR4 are associated with recurrent acute otitis media.
17900801 2007 AG490 influences UCN-01-induced cytotoxicity in glioma cells in a p53-dependent fashion, correlating with effects on BAX cleavage and BAD phosphorylation.
17889105 2007 Poly(ADP-ribose) polymerase expression in kidney transplantation: from alfa (alpha) to Omega (Omega).
17884996 2007 Dietary flavones and flavonoles are inhibitors of poly(ADP-ribose)polymerase-1 in pulmonary epithelial cells.
17785446 2007 The DNA binding and catalytic domains of poly(ADP-ribose) polymerase 1 cooperate in the regulation of chromatin structure and transcription.
17703177 2007 Differential expression in lupus-associated IL-10 promoter single-nucleotide polymorphisms is mediated by poly(ADP-ribose) polymerase-1.
17616514 2007 Expression of SMARCB1 modulates steroid sensitivity in human lymphoblastoid cells: identification of a promoter SNP that alters PARP1 binding and SMARCB1 expression.
17596754 2007 Poly(ADP-ribose) polymerase offers protection against oxidative and alkylation damage to the nuclear and mitochondrial genomes of the retinal pigment epithelium.
17562258 2007 [Inhibitory effect of 5-aminoisoquinolinone on PARP activity in colon carcinoma cell line HT-29].
17560163 2007 Analysis of genetic variants of the poly(ADP-ribose) polymerase-1 gene in breast cancer in French patients.
17548475 2007 Poly(ADP-ribose) polymerase 1 accelerates single-strand break repair in concert with poly(ADP-ribose) glycohydrolase.
17540609 2007 Oxidative DNA damage and augmentation of poly(ADP-ribose) polymerase/nuclear factor-kappa B signaling in patients with type 2 diabetes and microangiopathy.
17529993 2007 SET and PARP1 remove DEK from chromatin to permit access by the transcription machinery.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17518695 2007 Oxidative DNA damage repair and parp 1 and parp 2 expression in Epstein-Barr virus-immortalized B lymphocyte cells from young subjects, old subjects, and centenarians.
17459151 2007 Interaction between ATM and PARP-1 in response to DNA damage and sensitization of ATM deficient cells through PARP inhibition.
17428792 2007 Ataxia telangiectasia mutated (ATM) signaling network is modulated by a novel poly(ADP-ribose)-dependent pathway in the early response to DNA-damaging agents.
17413981 2007 Poly(adenosine diphosphate-ribose) polymerase expression in serous ovarian carcinoma: correlation with p53, MIB-1, and outcome.
17396150 2007 A novel human AP endonuclease with conserved zinc-finger-like motifs involved in DNA strand break responses.