Property Summary

Ligand Count 1,631
NCBI Gene PubMed Count 759
PubMed Score 4886.49
PubTator Score 4119.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Melanoma 711 0.0 2.7

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 1.3e-06
Breast cancer 1.100 3.3e-16
invasive ductal carcinoma 1.200 1.5e-04
lung adenocarcinoma 1.042 6.0e-08
lung cancer 1.100 8.5e-03
medulloblastoma, large-cell 1.100 6.2e-05
non-small cell lung cancer 1.188 7.8e-24
ovarian cancer 1.100 2.2e-03

Protein-protein Interaction (1)

PDB (52)

Gene RIF (698)

AA Sequence

MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVE      1 - 70
VDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLS     71 - 140
KKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKG    141 - 210
DEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAIL    211 - 280
DRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKV    281 - 350
KKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT    351 - 420
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPV    421 - 490
EVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLV    491 - 560
DIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKN    561 - 630
FTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK    631 - 700
LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLD    701 - 770
IEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE    771 - 840
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHT    841 - 910
SQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVN    911 - 980
DTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW                                        981 - 1014
//

Text Mined References (780)

PMID Year Title