Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.87
PubTator Score 6.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.0e-04
lung cancer 4740 2.3e-03
Disease Target Count Z-score Confidence
Urticaria 67 3.094 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 2.000 2.3e-03
psoriasis -1.200 9.0e-04

Gene RIF (1)

AA Sequence

MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSKDETIHIYDMK      1 - 70
KKIEHGALVHHSGTITCLKFYGNRHLISGAEDGLICIWDAKKWECLKSIKAHKGQVTFLSIHPSGKLALS     71 - 140
VGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSPRGEQYVVIIQNKIDIYQLDTASISGTITNEKRISSV    141 - 210
KFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMFSFEIPEHHVIVSASSDGFIKMWKLKQDK    211 - 280
KVPPSLLCEINTNARLTCLGVWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTK    281 - 350
KRGLTGDSKKATKESGLISTKKRKMVEMLEKKRKKKKIKTMQ                                351 - 392
//

Text Mined References (18)

PMID Year Title