Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.33

Knowledge Summary

Patent

No data available

Synonym

Accession Q5JUK9 A5D6Y1 PAGE-3
Symbols CT16.6
GAGED1
PAGE-3

Gene

  Ortholog (3)

 Compartment GO Term (1)

 HCA RNA Cell Line (3)

AA Sequence

MSGHQRTRSRSRERRDDQDSNHPVGAVVAQELPSNDQLQQEEPPIESQDYTPGQERDEGALDFQVLGLAA      1 - 70
YLWELTRSKTGGERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV                                71 - 113
//

Text Mined References (6)

PMID Year Title