Property Summary

NCBI Gene PubMed Count 38
PubMed Score 416.75
PubTator Score 236.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 8.8e-05
ovarian cancer 8520 4.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Vulvitis 4 3.346 1.7
Exophthalmos 112 3.019 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.165 8.8e-05
ovarian cancer 1.600 4.3e-04

Protein-protein Interaction (5)

Gene RIF (29)

AA Sequence

MAPTIQTQAQREDGHRPNSHRTLPERSGVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQH      1 - 70
KHDLLTEPDLGVTIDLINPDTYRIDPNVLLDPADEKLLEEEIQAPTSSKRSQQHAKVVPWMRKTEYISTE     71 - 140
FNRYGISNEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYSKPRVTPVEVMPVFPD    141 - 210
FKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMD    211 - 280
YAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRRAKAGVQSGTNALLV    281 - 350
VKHRDMNEKELEAQEARKAQLENHEPEEEEEEEMETEEKEAGGSDEEQEKGSSSEKEGSEDEHSGSESER    351 - 420
EEGDRDEASDKSGSGEDESSEDEARAARDKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGG    421 - 490
QRSRSHSRSASPFPSGSEHSAQEDGSEAAASDSSEADSDSD                                 491 - 531
//

Text Mined References (47)

PMID Year Title