Property Summary

NCBI Gene PubMed Count 118
PubMed Score 281.82
PubTator Score 263.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6685 8.6e-19
osteosarcoma 7933 1.1e-06
tuberculosis 1563 5.6e-05
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1170 5.912 3.0
Disease Target Count Z-score Confidence
Hypersensitivity reaction type II disease 235 3.189 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -5.868 1.1e-06
tuberculosis 2.100 5.6e-05
psoriasis -2.000 8.6e-19

MLP Assay (16)

AID Type Active / Inconclusive / Inactive Description
463073 screening 10 / 0 / 1990 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of Protein Arginine Deiminase 4 (PAD4)
463083 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4)
485272 screening 1334 / 0 / 324800 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of Protein Arginine Deiminase 4 (PAD4) (1536 HTS)
488796 screening 330 / 0 / 852 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of Protein Arginine Deiminase 4 (PAD4)
492970 confirmatory 1 / 0 / 9 Fluorescence-based biochemical dose response assay to identify inhibitors of Protein Arginine Deiminase 4 (PAD4)
588416 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 16 against PAD4
588417 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 15 against PAD4
588418 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 13 against PAD4
588419 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 12 against PAD4
588420 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 11 against PAD4
More...

Gene RIF (122)

PMID Text
26546893 PADI4 rs1748033 gene polymorphism increased the risk of RA in a sample of the Iranian population.
26255191 We identified the presence of PADI3 mRNA expression in synovial tissue and PADI2 and PADI4 mRNA expressions in fibroblast-like synoviocytes from patients with rheumatoid arthritis.
26245941 PAD4 activity was significantly higher in cell-free synovial fluid of rheumatoid arthritis patients compared to osteoarthritis patients.
26149185 Data show that peptidylarginine deiminase type 4, mutated citrullinated vimentin and cyclic citrullinated peptides autoantibodies were detected in 24, 61 and 74% of rheumatoid arthritis (RA) patients, respectively.
26082376 Silencing of PADI4 attenuates the TNF-alpha-induced osteogenic differentiation of human mesenchymal stem cells.
26043831 PADI4-94G/A polymorphism is associated with susceptibility to rheumatoid arthritis in the overall population and in the Asian population.
26019128 PAD-4 is inhibited by PTPN22.
25562673 Data show that peptidyl arginine deiminase type IV (PADI4) polymorphisms and a functional haplotype are associated with rheumatoid arthritis.
25205591 We found that heterozygote genotypes for PADI4_89 were protectively associated with susceptibility to tuberculosis.
25138370 genetic variants in CDK6 and PADI4 were associated with anti-citrullinated cyclic peptide status in rheumatoid arthritis DRB1*04 negative patients
25126568 rADI not only reduced NO production but also caused cellular toxicity in nNOS-activated SH-SY5Y cells, suggesting a dual role for rADI in NOS-mediated neurotoxicity.
24901704 The prevalence and extent of ILD was markedly higher among RA patients with anti-PAD3/4 cross-reactive antibodies, even after accounting for relevant confounders, particularly among ever smokers.
24874575 We propose that the influence of PADI4 on IL6ST transcription plays a role in the control of IL6ST expression during lineage differentiation of hematopoietic stem/progenitor cells.
24594197 PAD2 and PAD4 have distinct substrate specificities.
24564960 PADI4 polymorphisms are risk factors contributed to rheumatoid arthritis susceptibility, especially for anti-CCP positive disease, and may confer higher risk of radiographic severity in Chinese Han population.
24454473 We found that PADI4 polymorphisms are associated with RA susceptibility, regardless of ACPA titers.
24140127 results suggest that the p50 subunit of NF-kappaB may play a role in the repression of PAD4 transcription during inflammation
23818587 Dysregulation of PAD4-mediated citrullination of nuclear GSK3beta activates TGF-beta signaling and induces epithelial-to-mesenchymal transition in breast cancer cells.
23698378 anti-PAD4 autoantibodies (identified by their cross-reactivity with PAD3) markedly increase the catalytic efficiency of PAD4.
23577190 PADI4 risk allele and HLA-DRB1 shared epitope are independent genetic risks for radiographic progression in Japanese rheumatoid arthritis patients
23450494 Our results suggested that rs2240340 in PADI4 gene is associated with susceptibility to rheumatoid arthritis in Yunnan.
23382808 Therefore, our data strongly suggest that the N-terminal Ca(2+) ions play critical roles in the full activation of the PAD4 enzyme.
23214088 The relationship between PADI4 and rheumatoid arthritis has been observed among Japanese.
23164236 Data indicate an association between peptidylarginine deiminase PADI4 and rheumatoid arthritis (RA) in the multiethnic population from South East Asia.
23028349 HP1-alpha and PADI4 are regulators of both immune genes and HERVs, and that multiple events of transcriptional reactivation in Multiple Sclerosis patients can be explained by the deficiency of a single mechanism of gene silencing.
22976394 Polymorphism in exon-4 of PADI4 gene showed significant association with rheumatoid arthritis (RA)and polymorphism in exon-3 exhibited moderate association with RA.
22944128 The synovial expression of cyclic citrullinated peptide and the generation of anti-CCP antibodies are strongly associated with shared epitope alleles and/or certain PADI4 gene SNPs in rheumatoid arthritis.
22907585 Data indicate that the declined PADI4 mRNA was significantly associated with Line-1 demethylation in hepatocellular carcinoma (HCC) patients.
22614825 Contact between stimulated T cells and monocyte-macrophages or cytokine-activated monocyte-macrophages constitutes a highly likely source of PAD2 and PAD4, which are observed in inflamed synovial tissues.
22552437 This meta-analysis suggests that PADI4 polymorphisms represent a significant risk factor for rheumatoid arthritis, especially in Asians.
22459419 No single point association between genotype and allele frequency was found for rheumatoid arthritis in Tunisia.
22334079 analysis of regulation of histone modification and chromatin structure by the p53-PADI4 pathway
21981985 The PADI4 single nucleotide polymorphisms and haplotypes were associated with rheumatoid arthritis susceptibility.
21731701 This paper demonstrates the functional role of dimerization in the regulation of PAD4 activity.
21698003 PADI4 expression is related to the tumorigenic process of esophageal cancer and deoxycholate-induced apoptosis.
21655091 Genome-wide analysis reveals PADI4 cooperates with Elk-1 to activate c-Fos expression in breast cancer cells
21602177 Serum PAD4, rheumatoid factor (RF) and anti-citrullinated protein antibody levels were measured in 42 lung cancer patients; expression of cytokeratin 7 (CK7), PAD4 and citrullinated proteins was visualized in 113 lung cancer tissues.
21584310 PAD4 citrullinates the Arg-Gly repeat region of RPS2, which is also an established site for Arg methylation by protein arginine methyltransferase 3 (PRMT3).
21466234 PAD4 autodeimination modulates the ability of PAD4 to interact with histone deacetylase 1, citrullinated histone H3, and protein arginine methyltransferase 1.
21454715 Citrullination of inhibitor of growth 4 (ING4) by peptidylarginine deminase 4 (PAD4) disrupts the interaction between ING4 and p53
21418828 PADI4 is associated with disease activity involved in rheumatoid arthritis pathogenesis and may be a RA pathogenic antigen.
21267570 Rheumatoid arthritis patients remain positive for anti-hPAD4 antibodies over time and some patients who are initially anti-hPAD4 negative become positive later in the disease course. Autoantibodies did not affect enzyme activity.
21245532 crystal structure of PAD4(SNP) was determined and it was found that the amino-acid substitutions in PAD4(SNP) only induced conformational changes within the N-terminal domain, not in the active centre for citrullination located in the C-terminal domain
21062850 PADI4 polymorphism highly predisposes male smokers to rheumatoid arthritis, and the genetic heterogeneity observed between Asian and European populations may be partly explained by differences in smoking prevalence among men.
21062850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21039740 Results indicate that PADI4 polymorphisms may not play an important role in the development of AS in Chinese Han population.
21039740 Observational study of gene-disease association. (HuGE Navigator)
20827398 PADI4 has an important role in the tumorigenesis of ovary cancers that are under the regulation of estrogen.
20630876 The highly divergent effects of modifications of CXCL5 on neutrophil influx underline the potential importance of tissue-specific interactions between chemokines and PAD or proteases.
20584675 HLA-DR4, PAD4 and STAT4 are overexpressed in rheumatoid arthritis and may be involved in the pathogenesis of RA.
20563870 These data indicated that PADI4 polymorphisms were unlikely to play an important role in the susceptibility to rheumatoid arthritis in Chinese Han population.
20563870 Observational study of gene-disease association. (HuGE Navigator)
20537173 A haplotype of nonsynonymous single-nucleotide polymorphisms in PADI4 contributes to development of rheumatoid arthritis regardless of anti-cyclic citrullinated peptide or erosive joint status.
20537173 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20496417 Autoimmunity to peptidyl arginine deiminase type 4 precedes clinical onset of rheumatoid arthritis.
20476860 Observational study of gene-disease association. (HuGE Navigator)
20233754 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20190809 Combination of PAD4 and HDAC2 inhibitors may be a potential strategy for cancer treatment.
20039406 Autoantibodies to PAD-4 inhibit in vitro citrullination of fibrinogen by PAD-4.
19843866 DNA damage induces the citrullination of various proteins in a p53/PADI4-dependent manner
19470526 In the largest study performed to date, the PADI4 genotype was not a significant risk factor for rheumatoid arthritis in people of European ancestry, in contrast to Asian populations.
19470526 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
19332633 PADI4 may be a new susceptibility gene independent of HLA-DRB1 for rheumatoid arthritis in Caucasian populations.
19332633 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19199253 The PADI4 SNPs and haplotypes are associated with RA susceptibility in Chinese. HLA-DRB1 shared epitope is also an important risky factor for RA.
19199253 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19199100 Quantitative PCR measured higher transcription of PADI4 in the synovial membrane of rheumatoid arthritis than in the samples of osteoarthritis and ankylosing spondylitis.
19158815 Observational study of gene-disease association. (HuGE Navigator)
19004619 The transcriptional regulation of three human PADI type genes (PADI1, PADI2 and PADI3) in the epidermis have been carried out.
18849993 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18764812 PADI4 SNPs, functional haplotype and PADI4 expression may contribute to an inherited predisposition to Rheumatoid arthritis in a Chinese population.
18764812 Observational study of gene-disease association. (HuGE Navigator)
18668562 The citrullinating enzyme PAD-4 was detected in synovial fluid from patients with rheumatoid arthritis, spondylarthritides, and osteoarthritis.
18633125 PADI4 genotype in combination with anti-CCPs and SE modulates clinical and serological characteristics of RA.
18633125 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18576335 Polymorphisms in the PADI4 gene influence the immune response to the PAD-4 protein, potentially contributing to disease propagation
18576335 Observational study of gene-disease association. (HuGE Navigator)
18505818 These results suggest a role of PAD4 in the regulation of p53 target gene expression.
18466513 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18466472 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18462498 The PADI-4 genotype is not associated with risk for rheumatoid arthritis in the Nurses' Health Study (NHS) and NHSII cohorts in any model.
18462498 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18398945 The presence of anti-PAD4 (anti-peptidyl arginine deiminase type IV) in rheumatoid arthritis (RA) indicates that PAD4 may act as an autoantigen that may play a role in the pathogenesis of RA
18292109 it was concluded that PADI4 is not a predictor of aggravation of functional impairment of rheumatoid arthritis in a Japanese population
18087673 PADI4 gene single nucleotide polymorphism was associated with rheumatoid arthritis
18087673 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17980669 Observational study of gene-disease association. (HuGE Navigator)
17980669 results indicate that haplotype 1 of PADI4 is associated with non-susceptibility to UC (ulcerative colitis), whereas haplotype 2 is susceptible to UC. Thus, it is likely that PADI4 is one of genetic determinants of UC in the Japanese population.
17968929 PAD-2 & PAD-4 are only isotypes expressed in synovial tissue in rheumatoid arthritis & other arthritides; inflammatory cells are major source, but PAD-4 also comes from hyperplastic synoviocytes; both isotypes probably involved in citrullination of fibrin
17911417 Polymorphisms of the PADI4 gene are not associated with rheumatoid arthritis and are unlikely to be responsible for the presence of anti-CCP autoantibodies in a white Hungarian population.
17888206 Observational study of genotype prevalence. (HuGE Navigator)
17868046 Observational study of gene-disease association. (HuGE Navigator)
17469103 Observational study of gene-disease association. (HuGE Navigator)
17469103 The PADI4 rheumatoid arthritis (RA) risk haplotype is associated with increased anti-cyclic citrullinated peptide levels in RA patients with disease of short duration, and PADI4 may play a role in early RA.
17265154 Meta-analysis of gene-disease association. (HuGE Navigator)
17216583 Data show that the functional haplotype of peptidylarginine deiminase IV, associated with susceptibility to rheumatoid arthritis, dominates apoptosis of acute T leukemia Jurkat cells.
16828881 Observational study of gene-disease association. (HuGE Navigator)
16828881 These results do not support a major role of the PADI4 gene, but further studies may contribute to clarify the genetic factors that regulate deimination.
16567635 observations provide structural insights into target protein recognition by histone modification enzymes and illustrate how PAD4 can target multiple arginine sites in the histone N-terminal tails
16519819 Observational study of gene-disease association. (HuGE Navigator)
16502257 PADI4 induces apoptosis mainly through cell cycle arrest and mitochondria-mediated pathway.
16469113 Variability of the PADI4 gene may influence susceptibility to rheumatoid arthritis in the German population.
16449362 Meta-analysis of gene-disease association. (HuGE Navigator)
16385500 Observational study of gene-disease association. (HuGE Navigator)
16380915 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16380915 There is strong support for an association of PADI4 with the development of rheumatoid arthritis, but only in the North American Rheumatoid Athritis Consortium cohort.
16355400 PAD4 is expressed in CD34(+) cells of bone marrow and distributed in derives of the multi-potent progenitor cells in diverse tissues. The development of tumor cells expressing PAD4 is possibly associated with abnormal proliferation of CD34(+) stem cells.
16200584 Observational study of gene-disease association. (HuGE Navigator)
16200584 Replication of association in individual samples strongly suggests that PADI4 is a true susceptibility gene for rheumatoid arthritis.
16060666 Recombinant protein arginine deiminase 4 catalyzes the hydrolytic deimination of arginine residues to produce citrulline and ammonia.
15998632 Observational study of gene-disease association. (HuGE Navigator)
15883854 Observational study of genotype prevalence. (HuGE Navigator)
15814578 Observational study of gene-disease association. (HuGE Navigator)
15731287 Observational study of gene-disease association. (HuGE Navigator)
15629448 hPADI2 and hPADI4 have different roles under physiological and pathological conditions
15345777 peptidylarginine deiminase 4 regulates histone Arg methylation by converting methyl-Arg to citrulline and releasing methylamine; data suggest that PAD4 mediates gene expression by regulating Arg methylation and citrullination in histones
15338034 Observational study of genotype prevalence. (HuGE Navigator)
15247907 Ca(2+)-induces activation of human PAD4
15077293 Observational study of gene-disease association. (HuGE Navigator)
15077293 A PADI4 susceptibility haplotype associated with RA in a Japanese population is not associated with RA in a UK population but other genes involved in the citrullinating pathway remain strong candidate
12833157 identified a haplotype of PADI4 associated with susceptibility to rheumatoid arthritis that affected stability of transcripts and was associated with levels of antibody to citrullinated peptide in sera from individuals with rheumatoid arthritis
12393868 PAD V is localized in the nucleus in Hela cells

AA Sequence

MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKKKSTGSSTWPL      1 - 70
DPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWT     71 - 140
WGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDK    141 - 210
VRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELP    211 - 280
EAVVFQDSVVFRVAPWIMTPNTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQD    281 - 350
EMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG    351 - 420
KEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLL    421 - 490
LASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLA    491 - 560
ESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFI    561 - 630
NDFFTYHIRHGEVHCGTNVRRKPFSFKWWNMVP                                         631 - 663
//

Text Mined References (124)

PMID Year Title
26546893 2015 Association between Peptidylarginine Deiminase Type 4 rs1748033 Polymorphism and Susceptibility to Rheumatoid Arthritis in Zahedan, Southeast Iran.
26255191 2016 The amount of citrullinated proteins in synovial tissue is related to serum anti-cyclic citrullinated peptide (anti-CCP) antibody levels.
26245941 2015 Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid.
26149185 2015 Comparative analysis of autoantibodies targeting peptidylarginine deiminase type 4, mutated citrullinated vimentin and cyclic citrullinated peptides in rheumatoid arthritis: associations with cytokine profiles, clinical and genetic features.
26082376 2015 Expression of PADI4 in patients with ankylosing spondylitis and its role in mediating the effects of TNF-? on the proliferation and osteogenic differentiation of human mesenchymal stem cells.
26043831 2015 Associations Between PADI4 Gene Polymorphisms and Rheumatoid Arthritis: An Updated Meta-analysis.
26019128 2015 The W620 Polymorphism in PTPN22 Disrupts Its Interaction With Peptidylarginine Deiminase Type 4 and Enhances Citrullination and NETosis.
25562673 2015 Polymorphisms and functional haplotype in PADI4: further evidence for contribution on rheumatoid arthritis susceptibility and anti-cyclic citrullinated peptide antibodies in a western Mexican population.
25416956 2014 A proteome-scale map of the human interactome network.
25205591 2015 Heterozygote genotypes for PADI4_89 were protectively associated with susceptibility to tuberculosis in Koreans.
25138370 2014 Non-HLA genes PTPN22, CDK6 and PADI4 are associated with specific autoantibodies in HLA-defined subgroups of rheumatoid arthritis.
25126568 2014 Depletion of arginine by recombinant arginine deiminase induces nNOS-activated neurotoxicity in neuroblastoma cells.
24901704 2014 Association of cross-reactive antibodies targeting peptidyl-arginine deiminase 3 and 4 with rheumatoid arthritis-associated interstitial lung disease.
24874575 2014 PADI4 acts as a coactivator of Tal1 by counteracting repressive histone arginine methylation.
24594197 2014 The human peptidylarginine deiminases type 2 and type 4 have distinct substrate specificities.
24564960 Association between PADI4 gene polymorphisms and anti-cyclic citrullinated peptide antibody positive rheumatoid arthritis in a large Chinese Han cohort.
24454473 2013 PADI4 haplotypes in association with RA Mexican patients, a new prospect for antigen modulation.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24140127 2014 Negative regulation of the peptidylarginine deiminase type IV promoter by NF-?B in human myeloid cells.
23818587 2013 Dysregulation of PAD4-mediated citrullination of nuclear GSK3? activates TGF-? signaling and induces epithelial-to-mesenchymal transition in breast cancer cells.
23698378 2013 Erosive rheumatoid arthritis is associated with antibodies that activate PAD4 by increasing calcium sensitivity.
23577190 2013 PADI4 and HLA-DRB1 are genetic risks for radiographic progression in RA patients, independent of ACPA status: results from the IORRA cohort study.
23450494 2013 [Association of polymorphisms of PTPN22 and PADI4 genes with rheumatoid arthritis in Yunnan].
23382808 2013 Functional roles of the non-catalytic calcium-binding sites in the N-terminal domain of human peptidylarginine deiminase 4.
23214088 2012 [Rheumatoid arthritis: progress in diagnosis and treatment. Topics: I. Pathogenesis; 1. Genetic factors of rheumatoid arthritis].
23164236 2012 Polymorphisms in peptidylarginine deiminase associate with rheumatoid arthritis in diverse Asian populations: evidence from MyEIRA study and meta-analysis.
23028349 2012 Citrullination of histone H3 interferes with HP1-mediated transcriptional repression.
22976394 2012 Association of single nucleotide polymorphisms (SNPs) of PADI4 gene with rheumatoid arthritis (RA) in Indian population.
22944128 2012 [Association between the synovial expression of cyclic citrullinated peptide and susceptibility variants of HLA-DRB1 shared epitope alleles and PADI 4 gene single nucleotide polymorphisms in patients with rheumatoid arthritis].
22907585 2013 Decreased PADI4 mRNA association with global hypomethylation in hepatocellular carcinoma during HBV exposure.
22614825 2012 Contact with stimulated T cells up-regulates expression of peptidylarginine deiminase 2 and 4 by human monocytes.
22552437 2013 PADI4 polymorphisms and susceptibility to rheumatoid arthritis: a meta-analysis.
22459419 2012 Lack of association between PADI4 polymorphisms and rheumatoid arthritis in the Tunisian population.
22334079 2012 Regulation of histone modification and chromatin structure by the p53-PADI4 pathway.
22004374 2012 Synthesis and screening of a haloacetamidine containing library to identify PAD4 selective inhibitors.
21981985 2012 PADI4 polymorphisms and related haplotype in rheumatoid arthritis patients.
21882827 2011 The development of N-?-(2-carboxyl)benzoyl-N(5)-(2-fluoro-1-iminoethyl)-l-ornithine amide (o-F-amidine) and N-?-(2-carboxyl)benzoyl-N(5)-(2-chloro-1-iminoethyl)-l-ornithine amide (o-Cl-amidine) as second generation protein arginine deiminase (PAD) inhibitors.
21731701 2011 Functional role of dimerization of human peptidylarginine deiminase 4 (PAD4).
21698003 2011 Investigating the pathogenic role of PADI4 in oesophageal cancer.
21655091 2011 Genome-wide analysis reveals PADI4 cooperates with Elk-1 to activate c-Fos expression in breast cancer cells.
21602177 2011 Specific expression of PAD4 and citrullinated proteins in lung cancer is not associated with anti-CCP antibody production.
21584310 2011 Discovery of peptidylarginine deiminase-4 substrates by protein array: antagonistic citrullination and methylation of human ribosomal protein S2.
21505073 2011 The human AIRE gene at chromosome 21q22 is a genetic determinant for the predisposition to rheumatoid arthritis in Japanese population.
21466234 2011 Autodeimination of protein arginine deiminase 4 alters protein-protein interactions but not activity.
21454715 2011 Citrullination of inhibitor of growth 4 (ING4) by peptidylarginine deminase 4 (PAD4) disrupts the interaction between ING4 and p53.
21452313 2011 Genome-wide association study of rheumatoid arthritis in Koreans: population-specific loci as well as overlap with European susceptibility loci.
21418828 2011 [The significance of serum peptidylarginine deiminase 4 in rheumatoid arthritis].
21267570 2012 Anti-PAD4 autoantibodies in rheumatoid arthritis: levels in serum over time and impact on PAD4 activity as measured with a small synthetic substrate.
21245532 2011 Structural and biochemical analyses of the human PAD4 variant encoded by a functional haplotype gene.
21062850 2011 PADI4 polymorphism predisposes male smokers to rheumatoid arthritis.
21039740 2010 PADI4 gene polymorphism is not associated with ankylosing spondylitis in Chinese Han population.
20827398 2010 Expression of peptidylarginine deiminase type 4 in ovarian tumors.
20630876 2010 Posttranslational modification of the NH2-terminal region of CXCL5 by proteases or peptidylarginine Deiminases (PAD) differently affects its biological activity.
20584675 2010 [Association of HLA-DR4, PAD4, and STAT4 expression in the peripheral blood with disease activity in patients with rheumatoid arthritis].
20563870 2011 The PADI4 gene does not contribute to genetic susceptibility to rheumatoid arthritis in Chinese Han population.
20537173 2010 Peptidyl arginine deiminase type IV (PADI4) haplotypes interact with shared epitope regardless of anti-cyclic citrullinated peptide antibody or erosive joint status in rheumatoid arthritis: a case control study.
20496417 2010 Autoimmunity to peptidyl arginine deiminase type 4 precedes clinical onset of rheumatoid arthritis.
20476860 2010 Contribution of anti-CCP antibodies, proximal interphalangeal joint involvement, HLA-DRB1 shared epitope, and PADI4 as risk factors for the development of rheumatoid arthritis in palindromic rheumatism.
20233754 2010 Cumulative association of 22 genetic variants with seropositive rheumatoid arthritis risk.
20201080 2010 Autocitrullination of human peptidyl arginine deiminase type 4 regulates protein citrullination during cell activation.
20190809 2010 Coordination of PAD4 and HDAC2 in the regulation of p53-target gene expression.
20039406 2010 Rheumatoid arthritis-specific autoantibodies to peptidyl arginine deiminase type 4 inhibit citrullination of fibrinogen.
19843866 2009 Regulation of protein Citrullination through p53/PADI4 network in DNA damage response.
19470526 2010 PADI4 genotype is not associated with rheumatoid arthritis in a large UK Caucasian population.
19332633 2009 A functional haplotype of PADI4 gene in rheumatoid arthritis: positive correlation in a French population.
19199253 2009 [Association of the PADI4 gene polymorphism and HLA-DRB1 shared epitope alleles with rheumatoid arthritis].
19199100 2009 The expression of PADI4 in synovium of rheumatoid arthritis.
19158815 2009 Two-stage case-control association study of polymorphisms in rheumatoid arthritis susceptibility genes with schizophrenia.
19004619 2009 Transcriptional regulation of peptidylarginine deiminase expression in human keratinocytes.
18849993 2008 Common variants on 1p36 and 1q42 are associated with cutaneous basal cell carcinoma but not with melanoma or pigmentation traits.
18764812 2008 A functional haplotype and expression of the PADI4 gene associated with increased rheumatoid arthritis susceptibility in Chinese.
18668562 2008 Synovial fluid is a site of citrullination of autoantigens in inflammatory arthritis.
18633125 2009 Influence of peptidylarginine deiminase type 4 genotype and shared epitope on clinical characteristics and autoantibody profile of rheumatoid arthritis.
18576335 2008 Association of autoimmunity to peptidyl arginine deiminase type 4 with genotype and disease severity in rheumatoid arthritis.
18505818 2008 Regulation of p53 target gene expression by peptidylarginine deiminase 4.
18466513 2007 Evaluating gene x gene and gene x smoking interaction in rheumatoid arthritis using candidate genes in GAW15.
18466472 2007 Constructing gene association networks for rheumatoid arthritis using the backward genotype-trait association (BGTA) algorithm.
18462498 2008 Genetic polymorphisms in PTPN22, PADI-4, and CTLA-4 and risk for rheumatoid arthritis in two longitudinal cohort studies: evidence of gene-environment interactions with heavy cigarette smoking.
18398945 2008 Prevalence and significance of anti-peptidylarginine deiminase 4 antibodies in rheumatoid arthritis.
18292109 2008 Lack of association between PADI4 and functional severity in Japanese rheumatoid arthritis patients.
18209087 2008 Histone deimination as a response to inflammatory stimuli in neutrophils.
18087673 2008 Replication of reported genetic associations of PADI4, FCRL3, SLC22A4 and RUNX1 genes with rheumatoid arthritis: results of an independent Japanese population and evidence from meta-analysis of East Asian studies.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17980669 2008 Haplotypes of PADI4 susceptible to rheumatoid arthritis are also associated with ulcerative colitis in the Japanese population.
17968929 2007 Peptidyl arginine deiminase type 2 (PAD-2) and PAD-4 but not PAD-1, PAD-3, and PAD-6 are expressed in rheumatoid arthritis synovium in close association with tissue inflammation.
17911417 2007 Genetic background of anticyclic citrullinated peptide autoantibody production in Hungarian patients with rheumatoid arthritis.
17888206 Prevalence of functional haplotypes of the peptidylarginine deiminase citrullinating enzyme gene in patients with rheumatoid arthritis: no influence of the presence of anti-citrullinated peptide antibodies.
17868046 2007 Association of autoimmune disease-related gene polymorphisms with chronic graft-versus-host disease.
17469103 2007 Association of anti-cyclic citrullinated peptide antibody levels with PADI4 haplotypes in early rheumatoid arthritis and with shared epitope alleles in very late rheumatoid arthritis.
17265154 2007 PADI4 polymorphisms and rheumatoid arthritis susceptibility: a meta-analysis.
17216583 2007 The functional haplotype of peptidylarginine deiminase IV (S55G, A82V and A112G) associated with susceptibility to rheumatoid arthritis dominates apoptosis of acute T leukemia Jurkat cells.
17002273 2006 Inhibitors and inactivators of protein arginine deiminase 4: functional and structural characterization.
16828881 2006 PADI4 gene in multiple sclerosis: a family-based association study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16567635 2006 Structural basis for histone N-terminal recognition by human peptidylarginine deiminase 4.
16519819 2006 Analysis of polymorphisms in 16 genes in type 1 diabetes that have been associated with other immune-mediated diseases.
16502257 2006 Overexpression of peptidylarginine deiminase IV features in apoptosis of haematopoietic cells.
16469113 2006 Detailed analysis of the variability of peptidylarginine deiminase type 4 in German patients with rheumatoid arthritis: a case-control study.
16449362 2006 Association between PADI4 and rheumatoid arthritis: a meta-analysis.
16385500 2006 A functional haplotype of the PADI4 gene associated with increased rheumatoid arthritis susceptibility in Koreans.
16380915 2005 Replication of putative candidate-gene associations with rheumatoid arthritis in >4,000 samples from North America and Sweden: association of susceptibility with PTPN22, CTLA4, and PADI4.
16355400 2006 Expression of peptidylarginine deiminase type 4 (PAD4) in various tumors.
16200584 2005 Association between PADI4 and rheumatoid arthritis: a replication study.
16060666 2005 Kinetic characterization of protein arginine deiminase 4: a transcriptional corepressor implicated in the onset and progression of rheumatoid arthritis.
15998632 2005 PADI4 polymorphisms are not associated with rheumatoid arthritis in the Spanish population.
15883854 2005 Ethnic differences in allele frequency of autoimmune-disease-associated SNPs.
15814578 2005 Genetic and genomic studies of PADI4 in rheumatoid arthritis.
15731352 2005 Regulation of coactivator complex assembly and function by protein arginine methylation and demethylimination.
15731287 2005 Investigation of polymorphisms in the PADI4 gene in determining severity of inflammatory polyarthritis.
15629448 2005 Comparison of enzymatic properties between hPADI2 and hPADI4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345777 2004 Human PAD4 regulates histone arginine methylation levels via demethylimination.
15339660 2004 Histone deimination antagonizes arginine methylation.
15338034 2004 High variability of peptidylarginine deiminase 4 (PADI4) in a healthy white population: characterization of six new variants of PADI4 exons 2-4 by a novel haplotype-specific sequencing-based approach.
15247907 2004 Structural basis for Ca(2+)-induced activation of human PAD4.
15087120 2004 Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6.
15077293 2004 A functional haplotype of the PADI4 gene associated with rheumatoid arthritis in a Japanese population is not associated in a United Kingdom population.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12833157 2003 Functional haplotypes of PADI4, encoding citrullinating enzyme peptidylarginine deiminase 4, are associated with rheumatoid arthritis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393868 2002 Nuclear localization of peptidylarginine deiminase V and histone deimination in granulocytes.
11435484 2001 Immunocytochemical localization of peptidylarginine deiminase in human eosinophils and neutrophils.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10488123 1999 Molecular characterization of peptidylarginine deiminase in HL-60 cells induced by retinoic acid and 1alpha,25-dihydroxyvitamin D(3).