Property Summary

Ligand Count 3
NCBI Gene PubMed Count 50
PubMed Score 164.20
PubTator Score 115.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.724 3.0e-03
active ulcerative colitis -2.017 7.4e-03
atypical teratoid / rhabdoid tumor -1.800 1.2e-04
Breast cancer -1.500 7.3e-05
colon cancer -1.700 9.2e-03
ependymoma -1.100 4.3e-03
group 3 medulloblastoma -2.300 3.5e-02
lung cancer -3.100 2.2e-05
medulloblastoma, large-cell -2.200 3.4e-05
osteosarcoma -3.572 4.2e-06
pancreatic cancer 1.100 3.8e-03
pancreatic carcinoma 1.100 3.8e-03
primitive neuroectodermal tumor -1.900 3.2e-03
psoriasis -1.200 1.1e-06
tuberculosis 1.100 5.6e-03

Synonym

Accession Q9Y2J8 Q96DA7 Q9UPN2
Symbols PAD2
PDI2
PAD-H19

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

PDB (19)

Gene RIF (38)

AA Sequence

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWL      1 - 70
LSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASW     71 - 140
TWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSD    141 - 210
KVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDI    211 - 280
PLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQ    281 - 350
DEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN    351 - 420
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLL    421 - 490
MASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELG    491 - 560
LTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECT    561 - 630
FIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP                                       631 - 665
//

Text Mined References (51)

PMID Year Title