Property Summary

NCBI Gene PubMed Count 18
PubMed Score 45.65
PubTator Score 22.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.200 8.9e-03
astrocytic glioma 2.100 2.0e-03
ependymoma 2.000 6.2e-04
glioblastoma -1.100 1.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 9.2e-03
lung cancer 1.200 1.4e-02
oligodendroglioma 2.100 4.2e-04
osteosarcoma 1.155 6.7e-05

Gene RIF (2)

AA Sequence

MAAPLRIQSDWAQALRKDEGEAWLSCHPPGKPSLYGSLTCQGIGLDGIPEVTASEGFTVNEINKKSIHIS      1 - 70
CPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGLGVSSSTDGTMKIWQASNGELRRVLEGHVFDVNCC     71 - 140
RFFPSGLVVLSGGMDAQLKIWSAEDASCVVTFKGHKGGILDTAIVDRGRNVVSASRDGTARLWDCGRSAC    141 - 210
LGVLADCGSSINGVAVGAADNSINLGSPEQMPSEREVGTEAKMLLLAREDKKLQCLGLQSRQLVFLFIGS    211 - 280
DAFNCCTFLSGFLLLAGTQDGNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQD    281 - 350
LDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL                                351 - 392
//

Text Mined References (21)

PMID Year Title