Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.05
PubTator Score 1.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (1)

PMID Text
17584299 ZNF200 is a novel binding partner of G9a.

AA Sequence

MMAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETL      1 - 70
VIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFEDLNVFHCQEECVSLDPTQQLT     71 - 140
SEKEDDSSVGEMMLLAVNGSNPEGEDPEREPVENEDYREKSSDDDEMDSSLVSQQPPDNQEKERLNTSIP    141 - 210
QKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPY    211 - 280
DCNHCGKSFNHKTNLNKHERIHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPKNEE    281 - 350
FVLHLQSHEAERPYGCKKCGRRFGRLSNCTRHEKTHSACKTRKQK                             351 - 395
//

Text Mined References (9)

PMID Year Title
17584299 2007 Identification of ZNF200 as a novel binding partner of histone H3 methyltransferase G9a.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9787081 1998 Identification of two Krüppel-related zinc finger genes (ZNF200 and ZNF210) from human chromosome 16p13.3.
9653642 1998 A transcriptional Map of the FMF region.
9288094 1997 A candidate gene for familial Mediterranean fever.
8401585 1993 Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library.