Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.05
PubTator Score 1.91

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
colon cancer 1.100 6.4e-03
hepatocellular carcinoma 1.400 7.0e-05
intraductal papillary-mucinous neoplasm ... 1.300 2.7e-02
malignant mesothelioma 1.100 1.2e-04
ovarian cancer -1.200 4.8e-05
pancreatic cancer 1.100 2.7e-02
pancreatic carcinoma 1.100 2.7e-02
pituitary cancer 1.200 1.1e-05
tuberculosis -1.400 1.1e-04

Gene RIF (1)

AA Sequence

MMAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETL      1 - 70
VIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFEDLNVFHCQEECVSLDPTQQLT     71 - 140
SEKEDDSSVGEMMLLAVNGSNPEGEDPEREPVENEDYREKSSDDDEMDSSLVSQQPPDNQEKERLNTSIP    141 - 210
QKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPY    211 - 280
DCNHCGKSFNHKTNLNKHERIHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPKNEE    281 - 350
FVLHLQSHEAERPYGCKKCGRRFGRLSNCTRHEKTHSACKTRKQK                             351 - 395
//

Text Mined References (9)

PMID Year Title