Property Summary

NCBI Gene PubMed Count 36
Grant Count 95
R01 Count 36
Funding $49,842,924.82
PubMed Score 127.19
PubTator Score 23.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.544 0.000
astrocytoma 1.400 0.003
lung cancer 1.100 0.026
group 3 medulloblastoma 1.200 0.001
ovarian cancer 2.000 0.000

Synonym

Accession P98175 C4AM81 Q14136 Q5JRR2 Q9BTE4 Q9BTX0 Q9NTB1
Symbols S1-1
TARPS
GPATC9
ZRANB5
GPATCH9
DXS8237E

Gene

PDB

2LXI   2M2B   2MXV   2MXW  

 GO Component (2)

Gene RIF (11)

PMID Text
26751795 Src family tyrosine kinase signaling may regulate FilGAP through association with RBM10
25889998 The ability of RBM10v1 to regulate alternative splicing depends, at least in part, on a structural alteration within the second RNA recognition motif domain, and correlates with preferential expression of the NUMB exon 11 inclusion variant.
24530524 RBM10 regulates alternative splicing of Fas and Bcl-x genes.
24332178 Antagonizes the effects of RBM5, RBM6, and RBM10 in cell colony formation.
24000153 This study established RBM10 as an important regulator of alternative splicing, presented a mechanistic model for RBM10-mediated splicing regulation and provided a molecular link to understanding a human congenital disorder.
23294349 S1-1 contains multiple nuclear localisation sequence that act cooperatively.
20451169 Massively parallel sequencing of exons on the X chromosome identifies RBM10 as the gene that causes a syndromic form of cleft palate.
18854154 Knockdown of RNA binding motif protein 10 (RBM10) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18820371 results indicate that very few genes are involved in the last steps of the apoptotic cascade in breast cancer, among them one of the X-chromosome RBM family
18315527 S1-1 constitutes hundreds of nuclear domains, which dynamically change their structures in a reversible manner; upon globally reducing RNA polymerase II transcription, S1-1 nuclear bodies enlarge and decrease in number.
More...

AA Sequence

MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSAEDSY      1 - 70
EASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKASNIVMLRMLPQAA     71 - 140
TEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDATRWMEANQHSLNILGQKVSMHYSDPK    141 - 210
PKINEDWLCNKCGVQNFKRREKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQG    211 - 280
VLASQALSQGSEPSSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQL    281 - 350
STIVEAAQLLQILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQG    351 - 420
GEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGPEASLEPGADS    421 - 490
VSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQSPTHPSSALPPATSPTAQES    491 - 560
YSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYVPALEQSADGHKETG    561 - 630
APSKEGKEKKEKHKTKTAQQIAKDMERWARSLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKK    631 - 700
GALAERQHTSMDLPKLASDDRPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPS    701 - 770
KEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGG    771 - 840
ISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLGARGSSYGVTS    841 - 910
TESYKETLHKTMVTRFNEAQ                                                      911 - 930
//

Text Mined References (52)

PMID Year Title
26751795 2016 Src Family Tyrosine Kinase Signaling Regulates FilGAP through Association with RBM10.
25889998 2015 Insight into the role of alternative splicing within the RBM10v1 exon 10 tandem donor site.
25416956 2014 A proteome-scale map of the human interactome network.
24530524 2014 RBM10 regulates alternative splicing.
24332178 2013 RBM5, 6, and 10 differentially regulate NUMB alternative splicing to control cancer cell proliferation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24000153 2013 Integrative analysis revealed the molecular mechanism underlying RBM10-mediated splicing regulation.
23294349 2013 S1-1/RBM10: multiplicity and cooperativity of nuclear localisation domains.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...