Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.30
PubTator Score 4.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.800 0.000
tuberculosis and treatment for 6 months 1.200 0.001
lung cancer -1.500 0.039
ovarian cancer -1.400 0.000

Gene RIF (2)

PMID Text
19777325 Role of ZXD proteins in regulating MHC II transcription.
17493635 ZXDA and ZXDC form an important regulatory complex for MHC II gene transcription.

AA Sequence

MEIPKLLPARGTLQGGGGGGIPAGGGRVHRGPDSPAGQVPTRRLLLPRGPQDGGPGRRREEASTASRGPG      1 - 70
PSLFAPRPHQPSGGGDDFFLVLLDPVGGDVETAGSGQAAGPVLREEAKAGPGLQGDESGANPAGCSAQGP     71 - 140
HCLSAVPTPAPISAPGPAAAFAGTVTIHNQDLLLRFENGVLTLATPPPHAWEPGAAPAQQPRCLIAPQAG    141 - 210
FPQAAHPGDCPELRSDLLLAEPAEPAPAPAPQEEAEGLAAALGPRGLLGSGPGVVLYLCPEALCGQTFAK    211 - 280
KHQLKMHLLTHSSSQGQRPFKCPLGGCGWTFTTSYKLKRHLQSHDKLRPFGCPAEGCGKSFTTVYNLKAH    281 - 350
MKGHEQENSFKCEVCEESFPTQAKLGAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELF    351 - 420
SCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHDDDRRFMCPVEGCGKS    421 - 490
FTRAEHLKGHSITHLGTKPFVCPVAGCCARFSARSSLYIHSKKHLQDVDTWKSRCPISSCNKLFTSKHSM    491 - 560
KTHMVKRHKVGQDLLAQLEAANSLTPSSELTSQRQNDLSDAEIVSLFSDVPDSTSAALLDTALVNSGILT    561 - 630
IDVASVSSTLAGHLPANNNNSVGQAVDPPSLMATSDPPQSLDTSLFFGTAATGFQQSSLNMDEVSSVSVG    631 - 700
PLGSLDSLAMKNSSPEPQALTPSSKLTVDTDTLTPSSTLCENSVSELLTPAKAEWSVHPNSDFFGQEGET    701 - 770
QFGFPNAAGNHGSQKERNLITVTGSSFLV                                             771 - 799
//

Text Mined References (12)

PMID Year Title
26566883 2016 Homozygous missense mutation in the LMAN2L gene segregates with intellectual disability in a large consanguineous Pakistani family.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
19777325 2010 An N- and C-terminal truncated isoform of zinc finger X-linked duplicated C protein represses MHC class II transcription.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
17696781 2007 Sumoylation of the zinc finger protein ZXDC enhances the function of its transcriptional activation domain.
17493635 2007 The zinc finger proteins ZXDA and ZXDC form a complex that binds CIITA and regulates MHC II gene transcription.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...