Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.30
PubTator Score 4.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.0e-06
group 4 medulloblastoma 1855 5.8e-06
tuberculosis and treatment for 6 months 409 5.3e-04
lung cancer 4740 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Turner syndrome 28 4.06 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.200 5.8e-06
lung cancer -1.500 3.9e-02
ovarian cancer -1.400 3.0e-06
tuberculosis and treatment for 6 months 1.200 5.3e-04

Gene RIF (2)

AA Sequence

MEIPKLLPARGTLQGGGGGGIPAGGGRVHRGPDSPAGQVPTRRLLLPRGPQDGGPGRRREEASTASRGPG      1 - 70
PSLFAPRPHQPSGGGDDFFLVLLDPVGGDVETAGSGQAAGPVLREEAKAGPGLQGDESGANPAGCSAQGP     71 - 140
HCLSAVPTPAPISAPGPAAAFAGTVTIHNQDLLLRFENGVLTLATPPPHAWEPGAAPAQQPRCLIAPQAG    141 - 210
FPQAAHPGDCPELRSDLLLAEPAEPAPAPAPQEEAEGLAAALGPRGLLGSGPGVVLYLCPEALCGQTFAK    211 - 280
KHQLKMHLLTHSSSQGQRPFKCPLGGCGWTFTTSYKLKRHLQSHDKLRPFGCPAEGCGKSFTTVYNLKAH    281 - 350
MKGHEQENSFKCEVCEESFPTQAKLGAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELF    351 - 420
SCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHDDDRRFMCPVEGCGKS    421 - 490
FTRAEHLKGHSITHLGTKPFVCPVAGCCARFSARSSLYIHSKKHLQDVDTWKSRCPISSCNKLFTSKHSM    491 - 560
KTHMVKRHKVGQDLLAQLEAANSLTPSSELTSQRQNDLSDAEIVSLFSDVPDSTSAALLDTALVNSGILT    561 - 630
IDVASVSSTLAGHLPANNNNSVGQAVDPPSLMATSDPPQSLDTSLFFGTAATGFQQSSLNMDEVSSVSVG    631 - 700
PLGSLDSLAMKNSSPEPQALTPSSKLTVDTDTLTPSSTLCENSVSELLTPAKAEWSVHPNSDFFGQEGET    701 - 770
QFGFPNAAGNHGSQKERNLITVTGSSFLV                                             771 - 799
//

Text Mined References (12)

PMID Year Title