Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.70
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
ductal carcinoma in situ 2.000 2.4e-03
invasive ductal carcinoma 2.100 4.1e-03
primary Sjogren syndrome -1.500 3.3e-03

Protein-protein Interaction (4)

Gene RIF (10)

AA Sequence

MAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDY      1 - 70
TIVYFHYGLNSRNKPSLGWLQSAYKEFDRKDGDLTMWPRLVSNSKLKRSSHLSLPKYWDYRYKKNLKALY     71 - 140
VVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIPPEVLRYDEKLQSLHEGRTPPPT    141 - 210
KTPPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQ    211 - 280
GKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRSLPEHNYVVLR    281 - 350
YLMGFLHAVSRESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEYYEKIFSTPEAPGE    351 - 420
HGLAPWEQGSRAAPLQEAVPRTQATGLTKPTLPPSPLMAARRRL                              421 - 464
//

Text Mined References (21)

PMID Year Title