Property Summary

NCBI Gene PubMed Count 17
Grant Count 22
R01 Count 16
Funding $4,421,557.99
PubMed Score 248.57
PubTator Score 16.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.007

Gene RIF (6)

PMID Text
26732382 Data indicated the function of Foxk1 as a tumor suppressor in facilitating angiogenesis and metastasis in breast cancer.
26468278 FOXK1 protein levels and activity are regulated by associating with JLP and PLK1
25852164 Overall, these results demonstrate a novel role for FOXK1 in regulating the expression of antiviral genes via Nup98, from insects to humans.
25805136 FOXK1 and FOXK2 positively regulate Wnt/beta-catenin signaling by translocating dishevelled proteins into the nucleus.
22740631 FOXK1 binds to the promoter and regulates expression of DHFR, TYMS, GSDMD, and the E2F binding partner TFDP1.
16624804 crystallographic analysis of the FOXK1a-DNA complex

AA Sequence

MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPLPPGAIAGAGS      1 - 70
SGGSSGVSGDSAVAGAAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVTIGRNSSQGSVDLSMGL     71 - 140
SSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPKQCTFRFPSTAIKIQFTSLYHKEEA    141 - 210
PASPLRPLYPQISPLKIHIPEPDLRSMVSPVPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAA    211 - 280
EFAAKAASEQQADTSGGDSPKDESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQ    281 - 350
NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPAS    351 - 420
PTHPGLMSPRSGGLQTPECLSREGSPIPHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSL    421 - 490
VAKPVAYMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYILTSQGAAGGSHDAAGAAVLDL    491 - 560
GSEARGLEEKPTIAFATIPAAGGVIQTVASQMAPGVPGHTVTILQPATPVTLGQHHLPVRAVTQNGKHAV    561 - 630
PTNSLAGNAYALTSPLQLLATQASSSAPVVVTRVCEVGPKEPAAAVAATATTTPATATTASASASSTGEP    631 - 700
EVKRSRVEEPSGAVTTPAGVIAAAGPQGPGTGE                                         701 - 733
//

Text Mined References (28)

PMID Year Title
26732382 2016 Forkhead box protein k1 recruits TET1 to act as a tumor suppressor and is associated with MRI detection.
26468278 2015 JNK-associated Leucine Zipper Protein Functions as a Docking Platform for Polo-like Kinase 1 and Regulation of the Associating Transcription Factor Forkhead Box Protein K1.
25852164 2015 The transcription factor FoxK participates with Nup98 to regulate antiviral gene expression.
25805136 2015 FOXKs promote Wnt/?-catenin signaling by translocating DVL into the nucleus.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...