Property Summary

NCBI Gene PubMed Count 44
Grant Count 36
R01 Count 22
Funding $4,816,123.44
PubMed Score 100.60
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
hepatocellular carcinoma -1.300 0.000
pancreatic cancer -1.100 0.000
Multiple myeloma 1.768 0.009
malignant mesothelioma 1.400 0.000
psoriasis -1.100 0.000
cutaneous lupus erythematosus -1.800 0.001
group 3 medulloblastoma 1.700 0.003
atypical teratoid/rhabdoid tumor -2.000 0.000
Atopic dermatitis -1.500 0.000
tuberculosis and treatment for 6 months 1.200 0.000
non-small cell lung cancer -1.978 0.000
lung cancer -2.900 0.000
colon cancer -2.300 0.000
pancreatic carcinoma -1.100 0.000
subependymal giant cell astrocytoma -1.720 0.014
invasive ductal carcinoma -1.640 0.000
lung adenocarcinoma -1.630 0.000
Breast cancer -2.700 0.000
breast carcinoma -1.200 0.000
ovarian cancer -2.100 0.000
pituitary cancer 1.400 0.000
Down syndrome 1.100 0.001

Gene RIF (9)

PMID Text
26457357 H3F3A and H3F3B mutation analysis appears to be a highly specific, although less sensitive, diagnostic tool for the distinction of GCTB and chondroblastoma from other giant cell-containing tumors.
24162739 A remarkable picture of tumor type specificity for histone H3.3 driver alterations emerges, indicating that histone H3.3 residues, mutations and genes have distinct functions.
22174317 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20504901 DAXX functions as a bona fide histone chaperone involved in the replication-independent deposition of H3.3
18760861 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
14657027 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11689053 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11080476 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9566873 HIV-1 Rev interacting protein, H3 histone, family 3B (H3F3B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (87)

PMID Year Title
26457357 2015 Mutation Analysis of H3F3A and H3F3B as a Diagnostic Tool for Giant Cell Tumor of Bone and Chondroblastoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25416956 2014 A proteome-scale map of the human interactome network.
25245173 2015 Getting rhythm: how do babies do it?
24590075 2014 ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24183680 2013 Reduced H3K27me3 and DNA hypomethylation are major drivers of gene expression in K27M mutant pediatric high-grade gliomas.
24162739 2013 Distinct H3F3A and H3F3B driver mutations define chondroblastoma and giant cell tumor of bone.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...