Property Summary

NCBI Gene PubMed Count 23
PubMed Score 171.46
PubTator Score 15.27

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.60335925476378E-5
diabetes mellitus 1663 0.00139926706472209
Multiple myeloma 1328 0.00327308094075017
primary pancreatic ductal adenocarcinoma 1271 0.00413238812572739
Waldenstrons macroglobulinemia 765 0.00479310330366125
mucosa-associated lymphoid tissue lymphoma 480 0.00936906522726928


  Differential Expression (6)


Accession P84090 B2R5H2 P70659 Q14259
Symbols DROER



PANTHER Protein Class (1)


1W9G   2NML  

  Ortholog (16)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (11)

26100022 ERH regulation of RNA processing is needed to ensure faithful DNA replication and repair.
24078386 REVIEW: recent findings indicate that ERH plays an important role in cell cycle through its mRNA splicing activity and is critically required for genomic stability and cancer cell survival
24015320 Identification of amino acid residues of ERH required for its recruitment to nuclear speckles and replication foci
23236152 Evolutionarily conserved protein ERH controls CENP-E mRNA splicing and is required for the survival of KRAS mutant cancer cells.
22704934 ERH contributes to chromosome alignment at the metaphase plate by localizing CENP-E at kinetochore regions.
22174317 HIV-1 Rev interacting protein, enhancer of rudimentary homolog (ERH), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with ERH is increased by RRE
19460752 Knockdown of enhancer of rudimentary homolog (Drosophila, ERH) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18500978 Enhancer of rudimentary homolog (ERH) overexpression may be implicated in the initiation and/or progression of certain human malignancies.
18081865 interaction with ERH could block the binding of p21(Cip1/Waf1) by Ciz1 in the cell. When ERH and Ciz1 are coexpressed in HeLa cells, Ciz1 recruits ERH to DNA replication foci
17444515 ERH may be an important transcription regulator that also functions in the control of cell-cycle progression.

AA Sequence

VYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK                                         71 - 104

Text Mined References (31)

PMID Year Title
26100022 2015 Enhancer of Rudimentary Homolog Affects the Replication Stress Response through Regulation of RNA Processing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25284789 2014 5-Hydroxymethylcytosine plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex.
24078386 2013 The enigmatic ERH protein: its role in cell cycle, RNA splicing and cancer.
24015320 2013 Identification of amino acid residues of ERH required for its recruitment to nuclear speckles and replication foci in HeLa cells.
23236152 2012 Evolutionarily conserved protein ERH controls CENP-E mRNA splicing and is required for the survival of KRAS mutant cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22704934 2012 Enhancer of rudimentary homolog (ERH) plays an essential role in the progression of mitosis by promoting mitotic chromosome alignment.