Property Summary

NCBI Gene PubMed Count 24
PubMed Score 182.21
PubTator Score 15.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.600 1.4e-03
mucosa-associated lymphoid tissue lympho... -1.185 9.4e-03
Multiple myeloma 1.181 3.3e-03
osteosarcoma 1.651 1.6e-05
primary pancreatic ductal adenocarcinoma 1.035 4.1e-03
Waldenstrons macroglobulinemia 1.102 4.8e-03

Gene RIF (12)

AA Sequence

MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCL      1 - 70
VYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK                                         71 - 104
//

Text Mined References (33)

PMID Year Title