Property Summary

NCBI Gene PubMed Count 29
PubMed Score 23.07
PubTator Score 37.35

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG      1 - 70
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELT     71 - 140
DKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR                                  141 - 180
//

Text Mined References (32)

PMID Year Title