Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
R01 Count 5
Funding $565,569.33
PubMed Score 21.89
PubTator Score 37.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26000619 GORAB missense mutation disrupt ARF5 binding in Golgi apparatus in patients, with genetic skin diseases.
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 5 (ARF5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 5 (ARF5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 5 (ARF5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 5 (ARF5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22815487 BRAG2 acts at clathrin-coated pits to promote integrin internalization by activating Arf5 and suggest a previously unrecognized role for Arf5 in clathrin-mediated endocytosis of specific cargoes.
22573888 a novel molecular mechanism of circular dorsal ruffles ring size control through the ARAP1-Arf1/5 pathway.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22185782 The lipid droplets deposition and the cellular triacylglycerol content are significantly increased by siRNA-mediated depletion of Arf5.
22105072 a crucial role for class II Arf proteins (Arf4 and Arf5) in the dengue flavivirus life cycle

AA Sequence

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG      1 - 70
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELT     71 - 140
DKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR                                  141 - 180
//

Text Mined References (32)

PMID Year Title
26000619 2015 GORAB Missense Mutations Disrupt RAB6 and ARF5 Binding and Golgi Targeting.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23532257 2013 Genome-wide association study in a Chinese population identifies a susceptibility locus for type 2 diabetes at 7q32 near PAX4.
22815487 2012 BRAG2/GEP100/IQSec1 interacts with clathrin and regulates ?5?1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).
22573888 2012 ARAP1 regulates the ring size of circular dorsal ruffles through Arf1 and Arf5.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22185782 2011 GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis.
22105072 2012 Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses.
More...