Property Summary

NCBI Gene PubMed Count 17
Grant Count 10
R01 Count 5
Funding $490,848.92
PubMed Score 61.31
PubTator Score 21.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma -2.200 0.005
ependymoma -2.900 0.000
glioblastoma -2.900 0.000
oligodendroglioma -2.100 0.000
sonic hedgehog group medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
primitive neuroectodermal tumor -2.200 0.001
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -2.600 0.000
lung adenocarcinoma -1.200 0.000
Pick disease -1.100 0.013

Gene RIF (6)

PMID Text
25799108 Mutations in HPCA cause autosomal-recessive primary isolated dystonia.
22544757 analysis of a novel acetylation cycle of transcription co-activator Yes-associated protein that is downstream of Hippo pathway is triggered in response to SN2 alkylating agents
19686238 diminished hippocalcin expression does not contribute to Huntington disease-related neurodegeneration
19332348 Hippocalcin and MLK2 were colocalized in the halo of Lewy bodies in Parkinson disease patients, and neither protein was detected in normal pigmented neurons.
16053445 The structural factors affecting the binding of hippocalcin to phosphatidylinositol 4,5-bisphosphate at the cell surface and the Golgi apparatus are described.
14638856 Hippocalcin is a sensitive Ca2+ sensor capable of responding to increases in intracellular Ca2+ concentration over the narrow dynamic range of 200-800 nM free Ca2+.

AA Sequence

MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFR      1 - 70
TFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF                     141 - 193
//

Text Mined References (18)

PMID Year Title
25799108 2015 Mutations in HPCA cause autosomal-recessive primary isolated dystonia.
22544757 2012 A novel acetylation cycle of transcription co-activator Yes-associated protein that is downstream of Hippo pathway is triggered in response to SN2 alkylating agents.
19686238 2009 Diminished hippocalcin expression in Huntington's disease brain does not account for increased striatal neuron vulnerability as assessed in primary neurons.
19332348 2009 Mixed lineage kinase 2 and hippocalcin are localized in Lewy bodies of Parkinson's disease.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16053445 2005 High-affinity interaction of the N-terminal myristoylation motif of the neuronal calcium sensor protein hippocalcin with phosphatidylinositol 4,5-bisphosphate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638856 2003 Dynamics and calcium sensitivity of the Ca2+/myristoyl switch protein hippocalcin in living cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...