Property Summary

NCBI Gene PubMed Count 19
PubMed Score 62.87
PubTator Score 21.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.500 4.8e-04
astrocytic glioma -1.300 8.9e-03
Astrocytoma, Pilocytic -2.600 5.0e-07
atypical teratoid / rhabdoid tumor -3.200 3.6e-09
ependymoma -1.700 6.4e-03
glioblastoma -2.500 1.4e-09
lung adenocarcinoma -1.200 4.2e-09
medulloblastoma -1.200 3.5e-02
oligodendroglioma -2.100 1.8e-19
Pick disease -1.100 1.3e-02
primitive neuroectodermal tumor -2.200 6.7e-04

Gene RIF (8)

AA Sequence

MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFR      1 - 70
TFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF                     141 - 193
//

Text Mined References (20)

PMID Year Title