Property Summary

NCBI Gene PubMed Count 28
Grant Count 4
Funding $225,639.5
PubMed Score 175.80
PubTator Score 49.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.550 0.000
medulloblastoma, large-cell 1.300 0.000
primary pancreatic ductal adenocarcinoma 1.091 0.027
fibroadenoma -1.500 0.013
inflammatory breast cancer 2.000 0.039
pancreatic cancer 1.400 0.010

Gene RIF (23)

PMID Text
26110759 New insights into the structure and function of DeltaN-HtrA3, which seems to have a unique combination of features among human HtrA proteases.
25456008 HtrA3 is likely to be associated with the acquisition of the invasive phenotype in oral squamous cell carcinoma cells and may be a potential prognostic marker for oral cance
25274382 Data indicate that the levels of high temperature requirement factor A3 (HtrA3)protein were lower in all subtypes of ovarian cancer and the lowest levels of HtrA3 were in epithelial ovarian cancer.
25002585 HtrA1 and HtrA3 are crucial for trophoblast-decidual cell interaction in the control of trophoblast invasion.
23812730 Data indicate that in breast cancers with no lymphatic metastasis, the expression of HtrA3 was lower in patients with estrogen receptor (ER)- and progesterone receptor (PR)-positive tumors.
23049902 HtrA3 may have a role as an early marker for preeclampsia
22923201 results suggest that HtrA3 variants may play different roles in cancer development, and that the increased HtrA3-L levels in thyroid tissue could be correlated with the development of malignant lesions
21555518 HTRA3 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21321049 decidual HtrA3 negatively regulates trophoblast invasion
21047919 Abnormally high levels of serum HtrA3 at approximately 13-14 wk of gestation is associated with preeclampsia
More...

AA Sequence

MQARALLLAALAALALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVCAASEGEPCGGPLDSPC      1 - 70
GESLECVRGLCRCRWSHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQLQKGACPLGLHQLSSPRYKF     71 - 140
NFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQ    141 - 210
NGDSYEATIKDIDKKSDIATIKIHPKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRE    211 - 280
GRELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFLTEFQDKQIK    281 - 350
DWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSS    351 - 420
ELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM                                         421 - 453
//

Text Mined References (29)

PMID Year Title
26110759 2015 Structural and Functional Analysis of Human HtrA3 Protease and Its Subdomains.
25456008 2015 The high-temperature requirement factor A3 (HtrA3) is associated with acquisition of the invasive phenotype in oral squamous cell carcinoma cells.
25274382 2014 HTRA3 is reduced in ovarian cancers regardless of stage.
25002585 2014 Functional antagonism between high temperature requirement protein A (HtrA) family members regulates trophoblast invasion.
23812730 2013 HtrA3 is negatively correlated with lymph node metastasis in invasive ductal breast cancer.
23049902 2012 HtrA3 as an early marker for preeclampsia: specific monoclonal antibodies and sensitive high-throughput assays for serum screening.
22923201 2012 Changes in expression of human serine protease HtrA1, HtrA2 and HtrA3 genes in benign and malignant thyroid tumors.
22229724 2012 Application of the wheat-germ cell-free translation system to produce high temperature requirement A3 (HtrA3) proteases.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21321049 2011 Decidual HtrA3 negatively regulates trophoblast invasion during human placentation.
More...