Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.53
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.300 2.2e-02
osteosarcoma -1.830 2.3e-04
ovarian cancer 2.100 8.1e-06
pancreatic ductal adenocarcinoma liver m... -2.224 2.3e-02

Gene RIF (2)

AA Sequence

MAAPCVSYGGAVSYRLLLWGRGSLARKQGLWKTAAPELQTNVRSQILRLRHTAFVIPKKNVPTSKRETYT      1 - 70
EDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPEQIFPRQRAIQW     71 - 140
GEDGRPFHYLFYTGKQSYYSLMHDVYGMLLNLEKHQSHLQAKSLLPEKTVTRDVIGSRWLIKEELEEMLV    141 - 210
EKLSDLDYMQFIRLLEKLLTSQCGAAEEEFVQRFRRSVTLESKKQLIEPVQYDEQGMAFSKSEGKRKTAK    211 - 280
AEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSGGGRSAQAGAIRLAMAK    281 - 350
ALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQEGARRKFTWKKR                            351 - 396
//

Text Mined References (18)

PMID Year Title