Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.96
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession P82909 Q9H2H4 MRP-S36
Symbols DC47
MRP-S36

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGP      1 - 70
PDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE                                          71 - 103
//

Text Mined References (14)

PMID Year Title