Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.96
PubTator Score 1.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (1)

AA Sequence

MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGP      1 - 70
PDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE                                          71 - 103
//

Text Mined References (14)

PMID Year Title