Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.13
PubTator Score 1.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.13092675463977E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.04085126103985E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00329833099116687
astrocytic glioma 2241 0.0399562974302192

Expression

  Differential Expression (4)

Synonym

Accession P82909 Q9H2H4 MRP-S36
Symbols DC47
MRP-S36

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGP      1 - 70
PDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE                                          71 - 103
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...