Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.725 2.2e-04
ovarian cancer 1.200 5.5e-04
pancreatic ductal adenocarcinoma liver m... -1.069 1.6e-02

Synonym

Accession P82664 B2RE89 Q9H3E5 Q9NVR3 MRP-S10
Symbols MRP-S10
PNAS-122

Gene

PDB

3J9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPD      1 - 70
ILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLY     71 - 140
RCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS             141 - 201
//

Text Mined References (14)

PMID Year Title