Property Summary

NCBI Gene PubMed Count 19
PubMed Score 195.30
PubTator Score 28.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
tuberculosis 1563 1.99613670177342E-6
Pick disease 1893 5.15865074513259E-4
progressive supranuclear palsy 674 0.00655824358197014
medulloblastoma, large-cell 6234 0.0099108158758489
ovarian cancer 8492 0.0160340136376553
active Crohn's disease 918 0.0226286718445771
spina bifida 1064 0.0435045743570818
Disease Target Count Z-score Confidence
Mycosis fungoides 30 4.131 2.1
Presbyopia 19 3.935 2.0
Heart disease 279 3.091 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.010
tuberculosis -1.400 0.000
active Crohn's disease 1.378 0.023
spina bifida -1.548 0.044
Pick disease -1.200 0.001
progressive supranuclear palsy -1.300 0.007
ovarian cancer 1.100 0.016

Synonym

Accession P82094 B7ZLJ2 Q17R87 Q59GK0 TMF
Symbols TMF
ARA160

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (5)

PMID Text
24478191 In patient with chronic granulomatous disease, a 5.8-kb, incomplete and partly exonized TMF1 transcript was identified in intron 1 of CYBB, in opposite orientation to the host gene.
23239882 COG complex interacts with two different Rabs in addition to each end of the golgin "TATA element modulatory factor" (TMF).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19330832 Overexpression of TMF/ARA160 downregulates proangiogenic genes and attenuates the progression of prostate cancer xenografts.
17698061 These observations suggest critical roles for TMF in two Rab6-dependent retrograde transport processes: one from endosomes to the Golgi and the other from the Golgi to the endoplasmic reticulum.

AA Sequence

MSWFNASQLSSFAKQALSQAQKSIDRVLDIQEEEPSIWAETIPYGEPGISSPVSGGWDTSTWGLKSNTEP      1 - 70
QSPPIASPKAITKPVRRTVVDESENFFSAFLSPTDVQTIQKSPVVSKPPAKSQRPEEEVKSSLHESLHIG     71 - 140
QSRTPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVSLKVSESVIDVKTTMESI    141 - 210
SNTSTQSLTAETKDIALEPKEQKHEDRQSNTPSPPVSTFSSGTSTTSDIEVLDHESVISESSASSRQETT    211 - 280
DSKSSLHLMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDAFERIDSFSVQSLDSRSVSEINSDDELSG    281 - 350
KGYALVPIIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAEMEESGRSATPVNCEQPDILVSSTPINEG    351 - 420
QTVLDKVAEQCEPAESQPEALSEKEDVCKTVEFLNEKLEKREAQLLSLSKEKALLEEAFDNLKDEMFRVK    421 - 490
EESSSISSLKDEFTQRIAEAEKKVQLACKERDAAKKEIKNIKEELATRLNSSETADLLKEKDEQIRGLME    491 - 560
EGEKLSKQQLHNSNIIKKLRAKDKENENMVAKLNKKVKELEEELQHLKQVLDGKEEVEKQHRENIKKLNS    561 - 630
MVERQEKDLGRLQVDMDELEEKNRSIQAALDSAYKELTDLHKANAAKDSEAQEAALSREMKAKEELSAAL    631 - 700
EKAQEEARQQQETLAIQVGDLRLALQRTEQAAARKEDYLRHEIGELQQRLQEAENRNQELSQSVSSTTRP    701 - 770
LLRQIENLQATLGSQTSSWEKLEKNLSDRLGESQTLLAAAVERERAATEELLANKIQMSSMESQNSLLRQ    771 - 840
ENSRFQAQLESEKNRLCKLEDENNRYQVELENLKDEYVRTLEETRKEKTLLNSQLEMERMKVEQERKKAI    841 - 910
FTQETIKEKERKPFSVSSTPTMSRSSSISGVDMAGLQTSFLSQDESHDHSFGPMPISANGSNLYDAVRMG    911 - 980
AGSSIIENLQSQLKLREGEITHLQLEIGNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQ    981 - 1050
RYNTILQMYGEKAEEAEELRLDLEDVKNMYKTQIDELLRQSLS                              1051 - 1093
//

Text Mined References (31)

PMID Year Title
24478191 2014 Primary immunodeficiency caused by an exonized retroposed gene copy inserted in the CYBB gene.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23239882 2013 Molecular insights into vesicle tethering at the Golgi by the conserved oligomeric Golgi (COG) complex and the golgin TATA element modulatory factor (TMF).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...