Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.95
PubTator Score 13.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
glioblastoma 5572
Disease Target Count P-value
Breast cancer 3099 1.21981498112319E-22
lung carcinoma 2844 3.25133977720362E-16
ovarian cancer 8492 2.06698645905771E-9
pituitary cancer 1972 5.28781147503092E-9
psoriasis 6685 6.90646452742969E-7
lung cancer 4473 2.49044131962091E-6
colon cancer 1475 2.02344640673049E-5
pilocytic astrocytoma 3086 4.18371724185691E-5
medulloblastoma, large-cell 6234 1.13866963677391E-4
cystic fibrosis 1670 1.28164913404957E-4
Pick disease 1893 6.21987956476015E-4
osteosarcoma 7933 8.0628477009736E-4
medulloblastoma 1524 0.00195142894671847
atypical teratoid / rhabdoid tumor 4369 0.00253671107237046
adult high grade glioma 2148 0.00575243670756749
Common variable immunodeficiency 98 0.0139060045804801
oligodendroglioma 2849 0.0302255616949184
ependymoma 2514 0.0416791170235968
Disease Target Count Z-score Confidence
Brain cancer 24 0.0 1.0
glioblastoma multiforme 347 0.0 1.0

Expression

  Differential Expression (19)

Disease log2 FC p
glioblastoma -2.100 0.000
ependymoma -1.300 0.042
oligodendroglioma -1.600 0.030
psoriasis -1.100 0.000
osteosarcoma -1.965 0.001
atypical teratoid / rhabdoid tumor -2.100 0.003
medulloblastoma -1.200 0.002
medulloblastoma, large-cell -2.300 0.000
Common variable immunodeficiency -1.102 0.014
lung cancer -4.100 0.000
colon cancer -2.900 0.000
cystic fibrosis -1.200 0.000
adult high grade glioma -1.700 0.006
pilocytic astrocytoma -1.700 0.000
lung carcinoma 1.300 0.000
Pick disease -1.100 0.001
Breast cancer -2.200 0.000
ovarian cancer -1.700 0.000
pituitary cancer 2.000 0.000

Synonym

Accession P81877 B2R5W1 B7Z1J2 B7Z2L9 B7Z665 D6RH18 E9PB74 E9PDA8 Q8N2Q2 Q9BWW6 Q9Y4T7
Symbols HSPC116
SOSS-B2

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (9)

PMID Text
22472174 The minor allele of SSBP2 SNP rs17296479 and the increased tumor expression of SSBP2 were statistically significantly associated with poorer overall survival among glioblastoma patients
20658532 results indicate that cigarette smoking is a cause of SSBP2 promoter methylation and that SSBP2 harbors a tumor suppressive role in ESCC through inhibition of the Wnt signaling pathway
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19658100 ZNF198-FGFR1 is associated with phosphorylation of several proteins including SSBP2, ABL, FLJ14235, CALM and TRIM4 proteins.
18618714 SSBP2-JAK2 fusion gene resulting from a t(5;9)(q14.1;p24.1) is associated with pre-B acute lymphocytic leukemia.
18559593 SSBP2 inhibits prostate cancer cell proliferation and seems to represent a novel prostate cancer-specific DNA marker, especially in high stages of human prostate cancer.
17311003 Results suggest that subverting SSBP2 function by oncoprotein E1B55K may contribute to cell transformation by viral oncoproteins.
15782145 Our findings are consistent with human SSBP2 being a novel regulator of hematopoietic growth and differentiation, whose loss confers a block in differentiation advantage to myeloid leukemic cells.
12079286 Member of a closely related, evolutionarily conserved, and ubiquitously expressed gene family, potential tumor suppressor

AA Sequence

MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWD      1 - 70
LYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLR     71 - 140
IPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPG    141 - 210
MNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPN    211 - 280
RPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQS    281 - 350
ESYSPSMTMSV                                                               351 - 361
//

Text Mined References (27)

PMID Year Title
25916848 2015 RPA70 depletion induces hSSB1/2-INTS3 complex to initiate ATR signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22472174 2012 SSBP2 variants are associated with survival in glioblastoma patients.
21269460 2011 Initial characterization of the human central proteome.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
20658532 2011 Cigarette smoke induces promoter methylation of single-stranded DNA-binding protein 2 in human esophageal squamous cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19683501 2009 SOSS complexes participate in the maintenance of genomic stability.
More...