Property Summary

NCBI Gene PubMed Count 11
PubMed Score 143.66
PubTator Score 59.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Obesity 678 3.516 1.8

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRP      1 - 70
RLTCFPLEGGAMSSQDG                                                          71 - 87
//

Text Mined References (11)

PMID Year Title