Property Summary

NCBI Gene PubMed Count 11
Grant Count 19
R01 Count 14
Funding $2,006,219.18
PubMed Score 139.44
PubTator Score 59.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Obesity 616 3.35 1.7

Gene RIF (3)

PMID Text
23426574 Data indicate that formation of a primarily alpha-helical C-terminal region of prolactin releasing peptide (PrRP) is critical for receptor activation.
15891064 Review discusses the ancestral relationship between prolactin-releasing hormone and the C-terminal RF-motif amide precursor peptide (C-RF).
12126742 PrRP has a likely role in pheochromocytomas, based on its high expression in tumor tissue

AA Sequence

MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRP      1 - 70
RLTCFPLEGGAMSSQDG                                                          71 - 87
//

Text Mined References (11)

PMID Year Title
23426574 2013 The activity of prolactin releasing peptide correlates with its helicity.
15891064 2005 The ancestry of the prolactin-releasing hormone precursor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12126742 2002 Expression of prolactin-releasing peptide and its receptor in the human adrenal glands and tumor tissues of adrenocortical tumors, pheochromocytomas and neuroblastomas.
11523913 2001 Expression of prolactin-releasing peptide in human placenta and decidua.
11030716 2000 Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor.
10599733 1999 Expression of prolactin-releasing peptide and its receptor messenger ribonucleic acid in normal human pituitary and pituitary adenomas.
10498338 1999 Tissue distribution of prolactin-releasing peptide (PrRP) and its receptor.
10475064 1999 The quest for novel bioactive peptides utilizing orphan seven-transmembrane-domain receptors.
More...