Property Summary

NCBI Gene PubMed Count 29
PubMed Score 78.56
PubTator Score 47.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.800 3.4e-06
astrocytic glioma -1.700 4.3e-03
Astrocytoma, Pilocytic -1.300 5.6e-08
atypical teratoid / rhabdoid tumor -2.300 3.2e-03
Breast cancer 1.500 4.0e-04
Chronic Lymphocytic Leukemia -1.599 2.5e-04
cystic fibrosis 1.500 2.7e-04
Duchenne muscular dystrophy 1.053 1.4e-06
ductal carcinoma in situ 1.600 1.1e-03
ependymoma -2.100 1.5e-02
glioblastoma -1.700 1.4e-05
interstitial cystitis 1.300 3.6e-03
invasive ductal carcinoma 1.100 7.8e-03
lung cancer -2.100 6.0e-04
mucosa-associated lymphoid tissue lympho... 1.289 1.9e-02
nasopharyngeal carcinoma -1.300 3.3e-03
oligodendroglioma -1.200 1.6e-02
ovarian cancer -3.000 2.2e-10
pancreatic cancer 1.100 4.4e-03
primary pancreatic ductal adenocarcinoma 2.768 6.2e-05
primary Sjogren syndrome 2.600 7.9e-06
tuberculosis -1.900 2.7e-05
ulcerative colitis 3.600 1.2e-06
Waldenstrons macroglobulinemia 1.576 6.3e-04

Gene RIF (13)

AA Sequence

MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKE      1 - 70
GEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEE     71 - 140
PSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPK    141 - 210
PVEAPAANSDQTVTVKE                                                         211 - 227
//

Text Mined References (41)

PMID Year Title