Property Summary

NCBI Gene PubMed Count 27
Grant Count 13
R01 Count 10
Funding $1,254,876.45
PubMed Score 76.51
PubTator Score 47.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
25919928 Data suggest methylation status of gene promoters for BASP1 (brain abundant membrane attached signal protein 1) and CDH11 (cadherin 11) in tumor, skin, and metastatic tumor tissue may serve as prognostic biomarkers in patients with advanced melanoma.
24350992 Sequestration by BASP1 renders cells increasingly resistant to abrin toxicity.
24166496 Findings provide new insights into the function of prohibitin in transcriptional regulation and uncover a BASP1-prohibitin complex that plays an essential role in the PIP2-dependent recruitment of chromatin remodeling activities to the promoter.
23898208 HIV-1 Tat upregulates the expression of brain membrane attached signal protein 1 (BASP1) in human primary T cells
22939983 Repression of transcription by WT1-BASP1 requires the myristoylation of BASP1 and the PIP2-dependent recruitment of histone deacetylase.
21269271 Results suggest that BASP1 and WT1 play concerted, central roles in directing cell fate during differentiation. Here, BASP1/WT1 work to divert K562 cells away from blood cell lineage toward neuron phenotype.
19956849 BASP1 and SRD5A2 are methylated in early hepatocellular carcinoma
19376485 BASP1 and TPPsig-BASP1 genes were not involved in the etiology of Mobius syndrome.
18949357 Identification of novel aberrant methylation of BASP1 and SRD5A2 for early diagnosis of hepatocellular carcinoma by genome-wide search.
18268500 proteomic assessments of membrane microdomains in prefrontal cortex and validation in two brain series, strongly implicates LAMP, STXBP1 and BASP1 in schizophrenia and supports the view of a neuritic and synaptic dysfunction in the neuropathology
More...

AA Sequence

MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKE      1 - 70
GEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAPKAAEAAAAPAESAAPAAGEE     71 - 140
PSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPK    141 - 210
PVEAPAANSDQTVTVKE                                                         211 - 227
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25919928 2015 Novel DNA methylation markers with potential prognostic relevance in advanced malignant melanoma identified using COBRA assays.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24350992 2014 Sequestration of the abrin A chain to the nucleus by BASP1 increases the resistance of cells to abrin toxicity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24166496 2014 Prohibitin is required for transcriptional repression by the WT1-BASP1 complex.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...