Property Summary

NCBI Gene PubMed Count 43
Grant Count 46
R01 Count 25
Funding $3,480,820.97
PubMed Score 63.19
PubTator Score 61.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis 1.100 0.000

Gene RIF (24)

PMID Text
26559593 This study extends the description of biallelic mutations in NTHL1 beyond the single c.268C-->T,p.Q90* mutation that was observed previously.
26400813 NTH1 polymorphisms may be associated with non-small cell lung cancer pathogenesis.
25938944 A homozygous loss-of-function germline mutation in the NTHL1 gene predisposes to a new subtype of BER-associated adenomatous polyposis and colorectal cancer.
22465744 we demonstrated that hNEIL1 and hNTH1 cleave Oz sites as efficiently as 5-hydroxyuracil sites. Thus, hNEIL1 and hNTH1 can repair Oz lesions
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20574454 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19414504 Downregulation of NTH1 is associated with gastric cancer.
More...

AA Sequence

MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEG      1 - 70
SDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS     71 - 140
QTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAE    141 - 210
LVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING    211 - 280
LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL                                          281 - 312
//

Text Mined References (56)

PMID Year Title
26559593 2015 Biallelic NTHL1 Mutations in a Woman with Multiple Primary Tumors.
26400813 2015 DNA Base-Excision Repair Genes OGG1 and NTH1 in Brazilian Lung Cancer Patients.
25938944 2015 A germline homozygous mutation in the base-excision repair gene NTHL1 causes adenomatous polyposis and colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22465744 2012 A DNA oligomer containing 2,2,4-triamino-5(2H)-oxazolone is incised by human NEIL1 and NTH1.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21930793 2011 Nucleosome disruption by DNA ligase III-XRCC1 promotes efficient base excision repair.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
More...