Property Summary

NCBI Gene PubMed Count 48
PubMed Score 66.75
PubTator Score 61.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis 1.100 2.8e-05

 GWAS Trait (1)

Gene RIF (29)

AA Sequence

MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEG      1 - 70
SDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS     71 - 140
QTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAE    141 - 210
LVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING    211 - 280
LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL                                          281 - 312
//

Text Mined References (61)

PMID Year Title