Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
R01 Count 6
Funding $570,486.8
PubMed Score 33.15
PubTator Score 9.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (4)

PMID Text
26642925 Authors identify a novel association that implicates the IRX5 gene region in obesity and compare our results with previously derived interaction data for the region.
22581230 Our findings suggest that IRX proteins integrate combinatorial transcriptional inputs to regulate key signaling molecules involved in the ontogeny of multiple organs during embryogenesis and homeostasis.
18519790 Irx5 is involved in the regulation of both the cell cycle and apoptosis in human prostate cancer cells
16527195 involved in transcriptional regulation of heart morphogenesis

AA Sequence

MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPGYNSHLQYGAD      1 - 70
PAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNATRDATATLKAWLNEHRKNPY     71 - 140
PTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWTPRNRSEDEEEEENIDLEKNDEDEPQKPEDK    141 - 210
GDPEGPEAGGAEQKAASGCERLQGPPTPAGKETEGSLSDSDFKEPPSEGRLDALQGPPRTGGPSPAGPAA    211 - 280
ARLAEDPAPHYPAGAPAPGPHPAAGEVPPGPGGPSVIHSPPPPPPPAVLAKPKLWSLAEIATSSDKVKDG    281 - 350
GGGNEGSPCPPCPGPIAGQALGGSRASPAPAPSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNYGSFGH    351 - 420
LHGHPGPGPGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPYELKKGMSDI           421 - 483
//

Text Mined References (12)

PMID Year Title
26642925 2015 Complete re-sequencing of a 2Mb topological domain encompassing the FTO/IRXB genes identifies a novel obesity-associated region upstream of IRX5.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22581230 2012 Mutations in IRX5 impair craniofacial development and germ cell migration via SDF1.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
18519790 2008 The iroquois homeobox gene 5 is regulated by 1,25-dihydroxyvitamin D3 in human prostate cancer and regulates apoptosis and the cell cycle in LNCaP prostate cancer cells.
16527195 2006 [Irx5: a transcription factor that regulates the cardiac repolarization gradient].
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...