Tbio | Phylloquinone omega-hydroxylase CYP4F2 |
Omega-hydroxylase that oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids and xenobiotics. Plays a key role in vitamin K catabolism by mediating omega-hydroxylation of vitamin K1 (phylloquinone), and menaquinone-4 (MK-4), a form of vitamin K2. Hydroxylation of phylloquinone and MK-4 probably regulates blood coagulation (PubMed:19297519, PubMed:24138531). Also shows arachidonic acid omega-hydroxylase activity in kidney, by mediating conversion of arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE), possibly influencing blood pressure control (PubMed:10660572, PubMed:17341693, PubMed:18574070). Also acts as a leukotriene-B(4) omega-hydroxylase by mediating conversion of leukotriene-B(4) (LTB4) to its omega-hydroxylated metabolite 20-hydroxyleukotriene-B(4) (20-OH LTB4) (PubMed:8026587, PubMed:9799565).
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F11, is approximately 16 kb away. [provided by RefSeq, Jul 2008]
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F11, is approximately 16 kb away. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 3.86890103687528E-8 |
osteosarcoma | 7933 | 1.08737156486938E-5 |
lung cancer | 4473 | 3.75272587555369E-5 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 0.0248969327260137 |
active Crohn's disease | 918 | 0.0279390251174993 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Atrial Fibrillation | 110 | 3.413 | 1.7 |
Hypertension | 293 | 3.193 | 1.6 |
Cerebrovascular disease | 231 | 3.023 | 1.5 |
Disease | Target Count |
---|---|
Coumarin Resistance | 5 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -2.217 | 0.000 |
pancreatic ductal adenocarcinoma liver m... | -1.785 | 0.025 |
lung cancer | 2.300 | 0.000 |
active Crohn's disease | -2.216 | 0.028 |
ovarian cancer | 1.100 | 0.000 |
PMID | Text |
---|---|
26634476 | Did not find any association of the CYP4F2 gene rs2108622 polymorphism with hypertension. |
26483195 | Study showed that the V433M polymorphism in CYP4F2, responsible for epoxyeicosatrienoic acids synthesis, was an independent risk factor for post-transplant diabetes mellitus. |
26176903 | Bearing of two minor alleles of CYP4F2 missense variant modestly explains inter-ethnic differences of studied populations. CYP4F2*3 risk allele frequency of Roma was in higher range, and of Hungarians in lower range, compared with other world populations |
26024874 | Polymorphisms in CYP4F2 gene is associated with warfarin dose changes in different race during venous thromboembolism. |
25747538 | Plasma VK1 and MK-4 concentrations are influenced by CYP4F2 genetic polymorphism but not associated with warfarin therapy in Japanese patients. CYP4F2 polymorphism is poorly associated with inter-individual variability of warfarin dosage requirement. |
25734770 | To evaluate the associations between four single-nucleotide polymorphisms (SNPs) in CYP4A11 and CYP4F2 and ischemic stroke (IS) |
25730002 | CYP4F2 gene polymorphism might increase the risk of ischemic stroke in the Chinese population. |
25712182 | CYP2C19*2*2 versus *1*1 and *1*2 genotype (OR: 11.625; 95% CI: 3.498-38.633), CYP4F2 AA versus GA and GG genotype (OR: 3.532; 95% CI: 1.153-10.822) were associated with early stent thrombosis. |
25521356 | Our study of 250 cases of major bleeding found that CYP2C9*3 (OR: 2.05, 95% CI [1.04,4.04]), but not CYP2C9*2, VKORC1 or CYP4F2, increased the risk of major bleeding |
25370453 | Although initial studies on CYP4F2 were focused on its role as a regulator of LTB4 and 20-HETE, current investigations focus on how variants of CYP4F2 affect warfarin drug dosing and safety |
More... |
MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPT 1 - 70 EEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSA 71 - 140 GDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSF 141 - 210 DSHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPS 211 - 280 QGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY 281 - 350 QERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC 351 - 420 LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFR 421 - 490 VLPDHTEPRRKPELVLRAEGGLWLRVEPLS 491 - 520 //
PMID | Year | Title |
---|---|---|
26634476 | 2015 | Association of the CYP4F2 rs2108622 genetic polymorphism with hypertension: a meta-analysis. |
26483195 | 2016 | Risk factors for post-transplant diabetes mellitus in renal transplant: Role of genetic variability in the CYP450-mediated arachidonic acid metabolism. |
26176903 | 2015 | Interethnic variability of CYP4F2 (V433M) in admixed population of Roma and Hungarians. |
26024874 | 2015 | Race influences warfarin dose changes associated with genetic factors. |
25747538 | 2015 | Plasma vitamin K concentrations depend on CYP4F2 polymorphism and influence on anticoagulation in Japanese patients with warfarin therapy. |
25734770 | 2015 | Cytochrome 4A11 Genetic Polymorphisms Increase Susceptibility to Ischemic Stroke and Associate with Atherothrombotic Events After Stroke in Chinese. |
25730002 | 2015 | CYP4F2 gene single nucleotide polymorphism is associated with ischemic stroke. |
25712182 | 2015 | Effect of clinical factors and gene polymorphism of CYP2C19*2, *17 and CYP4F2*3 on early stent thrombosis. |
25521356 | 2014 | Genotype and risk of major bleeding during warfarin treatment. |
25411281 | 2014 | Meta-analysis of genome-wide association studies for circulating phylloquinone concentrations. |
More... |