Property Summary

NCBI Gene PubMed Count 113
Grant Count 33
R01 Count 33
Funding $3,259,593.36
PubMed Score 135.10
PubTator Score 169.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.217 0.000
pancreatic ductal adenocarcinoma liver m... -1.785 0.025
lung cancer 2.300 0.000
active Crohn's disease -2.216 0.028
ovarian cancer 1.100 0.000

Gene RIF (106)

PMID Text
26634476 Did not find any association of the CYP4F2 gene rs2108622 polymorphism with hypertension.
26483195 Study showed that the V433M polymorphism in CYP4F2, responsible for epoxyeicosatrienoic acids synthesis, was an independent risk factor for post-transplant diabetes mellitus.
26176903 Bearing of two minor alleles of CYP4F2 missense variant modestly explains inter-ethnic differences of studied populations. CYP4F2*3 risk allele frequency of Roma was in higher range, and of Hungarians in lower range, compared with other world populations
26024874 Polymorphisms in CYP4F2 gene is associated with warfarin dose changes in different race during venous thromboembolism.
25747538 Plasma VK1 and MK-4 concentrations are influenced by CYP4F2 genetic polymorphism but not associated with warfarin therapy in Japanese patients. CYP4F2 polymorphism is poorly associated with inter-individual variability of warfarin dosage requirement.
25734770 To evaluate the associations between four single-nucleotide polymorphisms (SNPs) in CYP4A11 and CYP4F2 and ischemic stroke (IS)
25730002 CYP4F2 gene polymorphism might increase the risk of ischemic stroke in the Chinese population.
25712182 CYP2C19*2*2 versus *1*1 and *1*2 genotype (OR: 11.625; 95% CI: 3.498-38.633), CYP4F2 AA versus GA and GG genotype (OR: 3.532; 95% CI: 1.153-10.822) were associated with early stent thrombosis.
25521356 Our study of 250 cases of major bleeding found that CYP2C9*3 (OR: 2.05, 95% CI [1.04,4.04]), but not CYP2C9*2, VKORC1 or CYP4F2, increased the risk of major bleeding
25370453 Although initial studies on CYP4F2 were focused on its role as a regulator of LTB4 and 20-HETE, current investigations focus on how variants of CYP4F2 affect warfarin drug dosing and safety
More...

AA Sequence

MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPT      1 - 70
EEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSA     71 - 140
GDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSF    141 - 210
DSHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPS    211 - 280
QGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY    281 - 350
QERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC    351 - 420
LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFR    421 - 490
VLPDHTEPRRKPELVLRAEGGLWLRVEPLS                                            491 - 520
//

Text Mined References (115)

PMID Year Title
26634476 2015 Association of the CYP4F2 rs2108622 genetic polymorphism with hypertension: a meta-analysis.
26483195 2016 Risk factors for post-transplant diabetes mellitus in renal transplant: Role of genetic variability in the CYP450-mediated arachidonic acid metabolism.
26176903 2015 Interethnic variability of CYP4F2 (V433M) in admixed population of Roma and Hungarians.
26024874 2015 Race influences warfarin dose changes associated with genetic factors.
25747538 2015 Plasma vitamin K concentrations depend on CYP4F2 polymorphism and influence on anticoagulation in Japanese patients with warfarin therapy.
25734770 2015 Cytochrome 4A11 Genetic Polymorphisms Increase Susceptibility to Ischemic Stroke and Associate with Atherothrombotic Events After Stroke in Chinese.
25730002 2015 CYP4F2 gene single nucleotide polymorphism is associated with ischemic stroke.
25712182 2015 Effect of clinical factors and gene polymorphism of CYP2C19*2, *17 and CYP4F2*3 on early stent thrombosis.
25521356 2014 Genotype and risk of major bleeding during warfarin treatment.
25411281 2014 Meta-analysis of genome-wide association studies for circulating phylloquinone concentrations.
More...