Property Summary

Ligand Count 1
NCBI Gene PubMed Count 120
PubMed Score 145.54
PubTator Score 169.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease -2.216 2.8e-02
lung cancer 2.300 3.8e-05
osteosarcoma -2.217 1.1e-05
ovarian cancer 1.100 3.9e-08
pancreatic ductal adenocarcinoma liver m... -1.785 2.5e-02

Gene RIF (112)

AA Sequence

MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPT      1 - 70
EEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSA     71 - 140
GDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSF    141 - 210
DSHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPS    211 - 280
QGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY    281 - 350
QERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC    351 - 420
LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFR    421 - 490
VLPDHTEPRRKPELVLRAEGGLWLRVEPLS                                            491 - 520
//

Text Mined References (122)

PMID Year Title