Property Summary

NCBI Gene PubMed Count 152
PubMed Score 26.16
PubTator Score 1994.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (40)

AA Sequence

MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLT      1 - 70
SLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVAS     71 - 140
ALSSRYH                                                                   141 - 147
//

Text Mined References (156)

PMID Year Title