Property Summary

NCBI Gene PubMed Count 53
Grant Count 8
R01 Count 4
Funding $708,461.92
PubMed Score 6.38
PubTator Score 4.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Gene

PDB

3RIG   3RIY   4F4U   4F56   2UXN   3A1B   4QBQ   4QBR   4QBS   2M0O   4Z0R   4L7X   4Z2M   2L75   2VPG   4UP0   5HJB   5HJD   1O9S   2RI7   3U5N   3U5O   3U5P   2CV5   3AFA   3AYW   3AZE   3AZF   3AZG   3AZH   3AZI   3AZJ   3AZK   3AZL   3AZM   3AZN   3W96   3W97   3W98   3W99   3WKJ   3X1S   3X1V   4YM5   4YM6   5AV5   5AV6   5AV8   5AV9   5AVB   5AVC   5B24   5B2I   5B2J   5B31   5CPI   5CPJ   5CPK   2C1J   2C1N   3SOU   3SOW   3ZVY   5IQL   4LXL   3O34   3O35   3O37   3WAA   4FWF   4HON   3WA9   3X1T   3X1U   5C3I   3AVR   2OQ6   2OT7   2OX0   3U4S   5D6Y   3KQI   3UEE   3UEF   3UIG   3UII   3UIK   4A0J   4A0N   5C13   4A7J   5HYN   3QJ6   2B2T   2B2U   2B2V   2B2W   5FB0   5FB1   2LBM   5HJC   3B95   4I51   3V43   4LK9   4LKA   4LLB   2KWJ   2KWK   4BD3   5FFV   4UY4   5T1G   3LQI   3LQJ   5DAH   1CS9   1CT6   1Q3L   3KMT   3U31   3U3D   3ZG6   4C1Q   4N4H   4TN7   4U68   4X3K   4YHP   4YHZ   5C11   5CH1   5CH2   5JHN   5JIN   5JJ0   5T1I  

Gene RIF (6)

PMID Text
20213041 These results uncover a novel role of CENP-F in regulation of epigenetic modification on histone H3.
20089855 CREB controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (94)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24788516 2014 Structural analysis of the KANSL1/WDR5/KANSL2 complex reveals that WDR5 is required for efficient assembly and chromatin targeting of the NSL complex.
24699735 2014 Structure of human nucleosome containing the testis-specific histone variant TSH2B.
24606918 2014 SAICAR induces protein kinase activity of PKM2 that is necessary for sustained proliferative signaling of cancer cells.
23415232 2013 Regulation of transcription through acetylation of H3K122 on the lateral surface of the histone octamer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
More...