Property Summary

NCBI Gene PubMed Count 59
PubMed Score 6.95
PubTator Score 4.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.400 8.8e-07
Breast cancer 2.400 4.6e-09
breast carcinoma 1.100 4.2e-02
colon cancer 2.000 2.5e-04
cutaneous lupus erythematosus 2.000 9.4e-04
cystic fibrosis 1.334 4.5e-05
ductal carcinoma in situ 1.700 4.8e-03
gastric cancer -1.200 2.3e-02
glioblastoma 1.200 6.4e-04
hepatocellular carcinoma 1.900 7.1e-05
inflammatory breast cancer 1.600 5.7e-04
intraductal papillary-mucinous carcinoma... 1.300 1.5e-02
intraductal papillary-mucinous neoplasm ... 2.800 3.8e-05
invasive ductal carcinoma 3.200 1.7e-03
lung adenocarcinoma 1.200 1.1e-08
lung cancer 1.900 5.8e-04
lung carcinoma -1.800 7.5e-13
malignant mesothelioma 2.600 9.7e-06
medulloblastoma, large-cell 2.100 5.3e-05
non-small cell lung cancer 1.138 2.4e-09
non-small cell lung carcinoma 1.200 8.7e-18
osteosarcoma 1.458 9.5e-07
ovarian cancer 1.200 1.6e-11
pancreatic cancer 3.200 1.6e-04
pancreatic carcinoma 3.200 1.6e-04
pediatric high grade glioma 1.500 8.2e-06
psoriasis -3.700 7.9e-05
sonic hedgehog group medulloblastoma 1.300 4.3e-02
spina bifida -2.578 3.9e-02
tuberculosis -1.200 1.3e-03

Gene

PDB

3RIG   3RIY   4F4U   4F56   2UXN   2X0L   5H6Q   5H6R   5X60   5GSU   5GT0   3A1B   4QBQ   4QBR   4QBS   2M0O   4Z0R   4L7X   4Z2M   5XFR   2L75   2VPG   4UP0   5T8R   2NDF   2NDG   5HJB   5HJD   1O9S   2RI7   3U5N   3U5O   3U5P   5V21   5V22   2CV5   3AFA   3AYW   3AZE   3AZF   3AZG   3AZH   3AZI   3AZJ   3AZK   3AZL   3AZM   3AZN   3W96   3W97   3W98   3W99   3WKJ   3X1S   3X1V   4YM5   4YM6   5AV5   5AV6   5AV8   5AV9   5AVB   5AVC   5B24   5B2I   5B2J   5B31   5CPI   5CPJ   5CPK   5GSE   5GTC   5JRG   5XF3   5XF4   5XF5   2C1J   2C1N   3SOU   3SOW   3ZVY   2VNF   5U2J   5IQL   4LXL   5TBN   5OY3   3O34   3O35   3O37   3WAA   4FWF   4HON   3WA9   3X1T   3X1U   5C3I   5GT3   3AVR   2OQ6   2OT7   2OX0   3U4S   5D6Y   3KQI   4Y6L   3UEE   3UEF   3UIG   3UII   3UIK   4A0J   4A0N   5C13   5WXG   5WXH   2CO0   4A7J   5HYN   3QJ6   5VGE   2B2T   2B2U   2B2V   2B2W   5FB0   5FB1   2LBM   5J3V   5HJC   5J9S   3B95   4I51   5GH9   3V43   4LK9   4LKA   4LLB   2KWJ   2KWK   4BD3   5FFV   4UY4   5SVX   5SVY   5T1G   3LQI   3LQJ   5DAH   1CS9   1CT6   1Q3L   2V85   2V89   3KMT   3MP1   3U31   3U3D   3ZG6   4C1Q   4N4H   4TN7   4U68   4X3K   4YHP   4YHZ   5C11   5JHN   5JIN   5JIY   5JJ0   5KJH   5KJI   5KKL   5LUG   5M5G   5T0K   5T0M   5T1I   5TDR   5TDW   5VA6   5VAB   5WLE  

Gene RIF (6)

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (109)

PMID Year Title