Property Summary

NCBI Gene PubMed Count 274
PubMed Score 671.35
PubTator Score 399.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 4.852 2.4
Lyme disease 26 4.456 2.2

Expression

Gene RIF (230)

AA Sequence

MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRN      1 - 70
GYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA     71 - 140
DRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSN    141 - 210
PPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRR    211 - 280
YRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE                              281 - 324
//

Text Mined References (288)

PMID Year Title