Property Summary

NCBI Gene PubMed Count 240
Grant Count 191
R01 Count 122
Funding $19,939,893.99
PubMed Score 644.13
PubTator Score 399.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P67809 P16990 P16991 Q14972 Q15325 Q5FVF0
Symbols YB1
BP-8
CSDB
DBPB
YB-1
CBF-A
CSDA2
EFI-A
NSEP1
NSEP-1
MDR-NF1

Gene

PDB

1H95  

Gene RIF (201)

PMID Text
26857528 YB-1 appears to be a promising target to inhibit the development of castration resistance, even at the AR variant-expressing stage. Polymorphism in the YB-1 gene may be a promising predictive biomarker in hormonal therapy.
26805816 hnRNPA2B1, hnRNPD, hnRNPL , and YBX1 might play important roles in gastric cancer tumorigenesis.
26512918 Describe a novel signaling network in which YB-1 regulates IL-6, and vice versa, creating a positive feed-forward loop driving EMT-like metastatic features during breast cancer progression.
26498684 Data show that Y box binding protein 1 (YBX1) positively controls the Internal Ribosome Entry Site (IRES) activity of the wild type, full-length CDKN2A/p16INK4a 5'-untranslated region (5'UTR).
26430912 Vital roles for YB1 in endothelial cell proliferation, apoptosis, and tube formation through transcriptional regulation of GC box-related genes.
26360636 HIV-1 MA interacts with YBX1
26360636 siRNA knockdown of YBX1 enhances HIV-1 replication; HIV-1 replication is restricted by EZR
26355086 YB-1 protects NS5A from degradation and likely regulates NS5A phosphorylation through its phosphorylation-dependent interaction with NS5A, which might be controlled by hepatitis C virus-induced signaling pathways.
26343856 HACE1 as a specific E3 ligase that polyubiquitinates YB-1 through non-canonical K27 linked ubiquitin chains.
26318844 YBX1 functions as a tumor promoter via NF-kappaB activation, and phosphorylation of S165 of YBX1 is critical for this function in colorectal carcinoma.
More...

AA Sequence

MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRN      1 - 70
GYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA     71 - 140
DRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSN    141 - 210
PPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRR    211 - 280
YRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE                              281 - 324
//

Text Mined References (253)

PMID Year Title
26857528 2016 Potential Role for YB-1 in Castration-Resistant Prostate Cancer and Resistance to Enzalutamide Through the Androgen Receptor V7.
26805816 2016 Unraveling Molecular Differences of Gastric Cancer by Label-Free Quantitative Proteomics Analysis.
26512918 2015 Interplay between YB-1 and IL-6 promotes the metastatic phenotype in breast cancer cells.
26498684 2015 The 5'-untranslated region of p16INK4a melanoma tumor suppressor acts as a cellular IRES, controlling mRNA translation under hypoxia through YBX1 binding.
26430912 2016 The Role of the Y Box Binding Protein 1 C-Terminal Domain in Vascular Endothelial Cell Proliferation, Apoptosis, and Angiogenesis.
26355086 2015 Y-Box Binding Protein 1 Stabilizes Hepatitis C Virus NS5A via Phosphorylation-Mediated Interaction with NS5A To Regulate Viral Propagation.
26343856 2015 HACE1 mediated K27 ubiquitin linkage leads to YB-1 protein secretion.
26318844 2015 Critical role of phosphorylation of serine 165 of YBX1 on the activation of NF-?B in colon cancer.
26314494 2015 The inhibitory effects of AR/miR-190a/YB-1 negative feedback loop on prostate cancer and underlying mechanism.
26240386 2015 Genome-wide analysis of YB-1-RNA interactions reveals a novel role of YB-1 in miRNA processing in glioblastoma multiforme.
More...