Property Summary

NCBI Gene PubMed Count 31
Grant Count 18
R01 Count 13
Funding $1,912,120.5
PubMed Score 83.08
PubTator Score 27.75

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (61)

PMID Text
27107594 ACTG2 is expressed in a fraction of small intestinal neuroendocrine tumors, can inhibit cell growth in vitro, and is positively regulated by miR-145.
26110787 gammaSMA expression in hepatocellular carcinoma is strongly correlated with the EMT process, HCC aggressiveness and the identification of cancer stem cells
25998219 Mutations within ACTG2 are associated with fetal megacystis in microcolon intestinal hypoperistalsis syndrome.
25782675 Phenotypic spectrum of ACTG2 missense variants involved severe pathology in multiple smooth muscle-dependent organs including the biliary tract and the uterus in the family with visceral myopathy.
24742657 Microarray analysis indicates HIV-1 Tat-induced upregulation of actin, gamma 2 (ACTG2) in primary human brain microvascular endothelial cells
24676022 ACTG2 encodes g2 enteric actin and is the first gene to be clearly associated with Megacystis-microcolon-intestinal hypoperistalsis syndrome, suggesting an important role for contractile proteins in enteric smooth muscle disease.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of actin, gamma 2 (ACTG2) in primary human brain microvascular endothelial cells
24337657 Two novel mutations in the ACTG2 gene, p.R178L and p.R178C, have been identified in two unrelated children with congenital distended bladder, microcolon, and intestinal hypoperistalsis (MMIHS).
23875777 Microarray analysis indicates HIV-1 Tat-induced upregulation of actin, gamma 2 (ACTG2) in primary human brain microvascular endothelial cells
23811015 Microarray analysis indicates HIV-1 Tat-induced upregulation of actin, gamma 2 (ACTG2) in primary human brain microvascular endothelial cells
More...

AA Sequence

MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY      1 - 70
PIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV     71 - 140
LSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIV    141 - 210
RDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTY    211 - 280
NSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASL    281 - 350
STFQQMWISKPEYDEAGPSIVHRKCF                                                351 - 376
//

Text Mined References (34)

PMID Year Title
27107594 2016 A plausible role for actin gamma smooth muscle 2 (ACTG2) in small intestinal neuroendocrine tumorigenesis.
26228148 2015 ACTIN-DIRECTED TOXIN. ACD toxin-produced actin oligomers poison formin-controlled actin polymerization.
26110787 2015 Gamma-smooth muscle actin expression is associated with epithelial-mesenchymal transition and stem-like properties in hepatocellular carcinoma.
25998219 2015 New Insights into the Genetics of Fetal Megacystis: ACTG2 Mutations, Encoding ?-2 Smooth Muscle Actin in Megacystis Microcolon Intestinal Hypoperistalsis Syndrome (Berdon Syndrome).
25782675 2015 Phenotypic expansion of visceral myopathy associated with ACTG2 tandem base substitution.
24777424 2014 Familial visceral myopathy diagnosed by exome sequencing of a patient with chronic intestinal pseudo-obstruction.
24676022 2014 Heterozygous de novo and inherited mutations in the smooth muscle actin (ACTG2) gene underlie megacystis-microcolon-intestinal hypoperistalsis syndrome.
24337657 2014 De novo ACTG2 mutations cause congenital distended bladder, microcolon, and intestinal hypoperistalsis.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...