Property Summary

NCBI Gene PubMed Count 35
PubMed Score 92.35
PubTator Score 27.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Ileus 19 4.399 2.2

Expression

  Differential Expression (19)

Disease log2 FC p
Breast cancer 2.600 3.9e-02
breast carcinoma -2.100 2.5e-03
colon cancer -6.600 3.9e-05
cystic fibrosis -3.995 7.6e-08
Endometriosis -1.891 2.5e-02
group 3 medulloblastoma 1.700 1.7e-02
intraductal papillary-mucinous adenoma (... -1.500 3.2e-03
intraductal papillary-mucinous carcinoma... -1.300 1.6e-02
intraductal papillary-mucinous neoplasm ... -1.300 4.8e-02
invasive ductal carcinoma -3.100 1.3e-02
lung adenocarcinoma -1.400 2.1e-07
lung carcinoma -1.800 5.6e-07
malignant mesothelioma -1.500 3.3e-07
non primary Sjogren syndrome sicca 1.200 2.4e-02
non-small cell lung carcinoma -1.400 5.3e-13
ovarian cancer 2.000 4.4e-02
Polycystic ovary syndrome -1.103 3.2e-02
posterior fossa group A ependymoma 1.200 3.0e-04
psoriasis -2.200 2.1e-04

 OMIM Phenotype (1)

Gene RIF (58)

AA Sequence

MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY      1 - 70
PIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAV     71 - 140
LSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIV    141 - 210
RDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTY    211 - 280
NSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASL    281 - 350
STFQQMWISKPEYDEAGPSIVHRKCF                                                351 - 376
//

Text Mined References (38)

PMID Year Title