Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.46
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.1e-06
group 3 medulloblastoma 4104 1.3e-05
medulloblastoma, large-cell 6241 2.4e-02
Disease Target Count Z-score Confidence
Asthma 385 0.0 0.9
Disease Target Count Z-score Confidence
fructose-1,6-bisphosphatase deficiency 7 3.034 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 2.300 1.3e-05
malignant mesothelioma 2.600 1.1e-06
medulloblastoma, large-cell 2.700 2.4e-02

Gene RIF (8)

AA Sequence

MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG      1 - 70
CVIS                                                                       71 - 74
//

Text Mined References (27)

PMID Year Title