Property Summary

NCBI Gene PubMed Count 27
Grant Count 3
R01 Count 2
Funding $102,899.54
PubMed Score 21.60
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Synonym

Accession P63211 A4D1H2 O43835 Q08447 Q16026 Q6LCP6
Symbols GNG1

Gene

Gene RIF (8)

PMID Text
25916507 Suggest Gbeta4gamma1 as a modulator of M3 muscarinic receptor signaling.
25675501 PhLP1 binding stabilizes the Gbeta fold, disrupting interactions with CCT and releasing a PhLP1-Gbeta dimer for assembly with Ggamma.
23954591 During corticogenesis, a cilium-transduced, noncanonical IGF-1R-Gbetagamma-phospho(T94)Tctex-1 signaling pathway promotes the proliferation of neural progenitors through modulation of ciliary resorption and G1 length.
22065575 WDR26 is a novel Gbetagamma-binding protein that is required for the efficacy of Gbetagamma signaling and leukocyte migration
20048162 Gbetagamma subunits enter in a protein complex with activated Rap1a and its effector Radil; this complex is required downstream of receptor stimulation for the activation of integrins and the positive modulation of cell-matrix adhesiveness.
17548351 Gbetagamma mediates UVB-induced human keratinocyte apoptosis by augmenting the ectodomain shedding of HB-EGF, which sequentially activates EGFR and p38
17110384 G protein betagamma subunits stimulate type V and VI adenylyl cyclases
15901556 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG      1 - 70
CVIS                                                                       71 - 74
//

Text Mined References (27)

PMID Year Title
25916507 2015 G?4?1 as a modulator of M3 muscarinic receptor signalling and novel roles of G?1 subunits in the modulation of cellular signalling.
25675501 2015 Structures of the G?-CCT and PhLP1-G?-CCT complexes reveal a mechanism for G-protein ?-subunit folding and G?? dimer assembly.
25416956 2014 A proteome-scale map of the human interactome network.
23954591 2013 IGF-1 activates a cilium-localized noncanonical G?? signaling pathway that regulates cell-cycle progression.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22065575 2011 The WD40 repeat protein WDR26 binds G?? and promotes G??-dependent signal transduction and leukocyte migration.
20048162 2010 G protein betagamma subunits regulate cell adhesion through Rap1a and its effector Radil.
17548351 2007 G Protein betagamma subunits augment UVB-induced apoptosis by stimulating the release of soluble heparin-binding epidermal growth factor from human keratinocytes.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
17110384 2007 Conditional stimulation of type V and VI adenylyl cyclases by G protein betagamma subunits.
More...