Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGVGTASEVYQSTEILHC      1 - 70
LGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKIP     71 - 140
VEAKINQKREGIGYPF                                                          141 - 156
//

Text Mined References (4)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18664271 2008 Expression patterns of transcribed human endogenous retrovirus HERV-K(HML-2) loci in human tissues and the need for a HERV Transcriptome Project.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.