Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

WASQVSENRPVCKAVIQGKQLEGLVDTGADVSIIALNQWPKNWPKQKTVTGLVGIVTASEVYQSTEILHC      1 - 70
LGPHNQESTVQPMITSIPLNLWGRDLLQQWGAEITMTATLYSPMSQKIMTKMGYIPGKGLGKNEDGIKVP     71 - 140
IEAKINHGREGTGYPF                                                          141 - 156
//

Text Mined References (17)

PMID Year Title