Knowledge Summary

Patent

No data available

AA Sequence

WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGISTASEVYQSTEILHC      1 - 70
LGPDNQESTVQPMITSIPLNLWGRDLLQQWGVEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKVP     71 - 140
VEAKINQEREGIGYPF                                                          141 - 156
//

Text Mined References (1)

PMID Year Title
11591322 2001 Insertional polymorphisms of full-length endogenous retroviruses in humans.