Property Summary

NCBI Gene PubMed Count 46
PubMed Score 74.43
PubTator Score 70.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
Alzheimer's disease -1.200 3.0e-02
active Crohn's disease 1.152 2.8e-03
adrenocortical carcinoma -1.575 1.2e-02
adult high grade glioma -4.600 5.3e-07
astrocytic glioma -3.700 6.0e-03
Astrocytoma, Pilocytic -5.500 4.7e-14
Atopic dermatitis 1.300 4.2e-04
atypical teratoid / rhabdoid tumor -5.900 4.9e-12
Breast cancer -1.900 4.3e-08
colon cancer 3.400 2.1e-03
cystic fibrosis 1.600 1.6e-04
ependymoma -4.700 2.9e-03
esophageal adenocarcinoma -2.200 2.0e-02
glioblastoma -4.700 1.5e-10
group 3 medulloblastoma -4.500 3.4e-06
Hydrolethalus syndrome -2.221 2.3e-02
interstitial cystitis -1.700 1.7e-04
lung cancer 2.500 1.2e-03
lung carcinoma -2.000 6.6e-14
medulloblastoma, large-cell -4.900 2.3e-06
non-small cell lung cancer 1.746 2.1e-06
oligodendroglioma -2.600 1.5e-02
osteosarcoma 1.809 9.8e-03
ovarian cancer 1.100 1.9e-02
Parkinson's disease -2.200 3.5e-02
Pick disease -2.800 4.6e-03
primitive neuroectodermal tumor -3.600 1.4e-04
psoriasis 1.400 9.4e-09
subependymal giant cell astrocytoma -3.549 1.8e-02
ulcerative colitis 1.300 7.1e-06

Synonym

Accession P62760 D6W515 P28677 P29103 P42323 Q9UM20 VILIP
Symbols HLP3
VILIP
HPCAL3
HUVISL1
VILIP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (35)

AA Sequence

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR      1 - 70
TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM     71 - 140
NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK                       141 - 191
//

Text Mined References (48)

PMID Year Title