Property Summary

NCBI Gene PubMed Count 46
Grant Count 16
R01 Count 7
Funding $1,358,942.3
PubMed Score 71.11
PubTator Score 70.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
astrocytoma -5.600 0.002
posterior fossa group A ependymoma -5.900 0.000
oligodendroglioma -4.500 0.000
esophageal adenocarcinoma -2.200 0.020
psoriasis 2.500 0.000
glioblastoma -5.800 0.000
osteosarcoma 1.809 0.010
medulloblastoma -5.800 0.000
atypical teratoid / rhabdoid tumor -7.100 0.000
medulloblastoma, large-cell -6.200 0.000
primitive neuroectodermal tumor -4.400 0.000
Atopic dermatitis 1.400 0.003
adrenocortical carcinoma -1.759 0.025
non-small cell lung cancer 2.467 0.000
Hydrolethalus syndrome -2.221 0.023
colon cancer 3.400 0.002
lung cancer 4.000 0.000
active Crohn's disease 1.745 0.002
Parkinson's disease -2.200 0.035
interstitial cystitis -1.700 0.000
cystic fibrosis 2.000 0.002
adult high grade glioma -6.000 0.000
pilocytic astrocytoma -6.100 0.000
subependymal giant cell astrocytoma -4.522 0.004
severe Alzheimer's disease -1.576 0.035
Breast cancer -1.900 0.000
lung carcinoma -2.000 0.000
Pick disease -3.400 0.007
ulcerative colitis 2.000 0.000
ovarian cancer 1.100 0.019

Gene RIF (35)

PMID Text
26836160 These data indicate that VILIP-1 alone or in combination with other AD CSF biomarkers represent a valuable marker for the early diagnosis of AD, recognition of MCI patients at higher risk to develop dementia, and in differentiating AD from LBD.
26769253 These findings suggest a unique role for cerebrospinal fluid Vilip-1 as a biomarker of entorhinal cortex neuron loss in Alzheimer disease
26683098 Underexpression of VSNL1 is associated with glioblastoma multiforme.
25019684 Results show that in the presence of calcium, N-myristoylation significantly increases the kinetic rate of VILIP adsorption to the membrane.
24742816 We show for the first time that the C-terminus of VILIP-1, containing Cys187, might represent a novel redox-sensitive motif and that VILIP-1 dimerization and aggregation are hallmarks of amyotrophic lateral sclerosis
24075506 The results suggest that both serum and cerebrospinal fluid levels of VILIP-1 may be one of predictive markers of acute encephalopathy with biphasic seizures.
23800322 The results showed that the CSF VILIP-1 level had significantly increased in Alzheimer disease patients compared with both normal controls and Lewy body dementia patients.
22832524 VSNL1 single-nucleotide polymorphisms and pathological changes in VILIP-1 protein expression, possibly occurring during brain development, may contribute to the morphological and functional deficits observed in schizophrenia.
22357717 The findings suggest that CSF VILIP-1 and VILIP-1/Abeta42 predict rates of global cognitive decline similarly to tau and tau/Abeta42, and may be useful CSF surrogates for neurodegeneration in early Alzheimer disease.
22331379 VSNL1 may play a role in the pathophysiology of aldosterone-producing adenomas harboring mutations in the potassium channel KCNJ5 via its antiapoptotic function in response to calcium cytotoxicity and its effect on aldosterone production.
More...

AA Sequence

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR      1 - 70
TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM     71 - 140
NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK                       141 - 191
//

Text Mined References (48)

PMID Year Title
26836160 2016 Predictive Value of Cerebrospinal Fluid Visinin-Like Protein-1 Levels for Alzheimer's Disease Early Detection and Differential Diagnosis in Patients with Mild Cognitive Impairment.
26769253 2016 Altered Levels of Visinin-Like Protein 1 Correspond to Regional Neuronal Loss in Alzheimer Disease and Frontotemporal Lobar Degeneration.
26683098 2016 Dysregulated miR-671-5p / CDR1-AS / CDR1 / VSNL1 axis is involved in glioblastoma multiforme.
25416956 2014 A proteome-scale map of the human interactome network.
25019684 2014 Specific interaction to PIP2 increases the kinetic rate of membrane binding of VILIPs, a subfamily of Neuronal Calcium Sensors (NCS) proteins.
24742816 2014 Dimerization of visinin-like protein 1 is regulated by oxidative stress and calcium and is a pathological hallmark of amyotrophic lateral sclerosis.
24075506 2014 Serum and cerebrospinal fluid levels of visinin-like protein-1 in acute encephalopathy with biphasic seizures and late reduced diffusion.
23800322 2013 CSF levels of the neuronal injury biomarker visinin-like protein-1 in Alzheimer's disease and dementia with Lewy bodies.
22832524 2011 Association of VSNL1 with schizophrenia, frontal cortical function, and biological significance for its gene product as a modulator of cAMP levels and neuronal morphology.
22357717 2012 CSF VILIP-1 predicts rates of cognitive decline in early Alzheimer disease.
More...