Property Summary

NCBI Gene PubMed Count 10
PubMed Score 23.02
PubTator Score 10.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
IGA Glomerulonephritis 454

Gene RIF (2)

PMID Text
23913443 Data suggest SELT is expressed in pancreatic beta- and delta-cells; inactivation of SELT in beta-cells leads to glucose intolerance via impaired glucose homeostasis and PACAP (pituitary adenylate cyclase-activating polypeptide) insulinotropic effect.
12775843 The paper reported that the full-length SELT protein contains 182 amino acids.

AA Sequence

MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIR      1 - 70
IEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIE     71 - 140
NQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS                   141 - 195
//

Text Mined References (10)

PMID Year Title
23913443 2013 The PACAP-regulated gene selenoprotein T is abundantly expressed in mouse and human ?-cells and its targeted inactivation impairs glucose tolerance.
17503775 2007 SelT, SelW, SelH, and Rdx12: genomics and molecular insights into the functions of selenoproteins of a novel thioredoxin-like family.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12775843 2003 Characterization of mammalian selenoproteomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10567350 1999 New mammalian selenocysteine-containing proteins identified with an algorithm that searches for selenocysteine insertion sequence elements.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.