Property Summary

NCBI Gene PubMed Count 33
PubMed Score 2.26
PubTator Score 13.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.300 2.0e-08
glioblastoma 1.200 7.2e-08
group 3 medulloblastoma 2.000 1.5e-05
lung cancer 1.600 7.4e-04
medulloblastoma, large-cell 1.500 3.4e-05
pediatric high grade glioma 1.300 1.0e-06
posterior fossa group A ependymoma 1.100 1.0e-07
primitive neuroectodermal tumor 1.300 1.3e-04

 GO Function (1)

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL      1 - 70
YIRGVEEEEEDGEMRE                                                           71 - 86
//

Text Mined References (38)

PMID Year Title