Property Summary

NCBI Gene PubMed Count 32
Grant Count 7
Funding $1,617,593.5
PubMed Score 1.81
PubTator Score 13.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

 GO Function (1)

Gene RIF (1)

PMID Text
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide F (SNRPF), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL      1 - 70
YIRGVEEEEEDGEMRE                                                           71 - 86
//

Text Mined References (37)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23333303 2013 Structural basis of assembly chaperone- mediated snRNP formation.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21516107 2011 Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
More...