Property Summary

NCBI Gene PubMed Count 22
Grant Count 8
R01 Count 5
Funding $1,526,964.66
PubMed Score 81.60
PubTator Score 21.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25893343 Report dysregulated expression of RPS23 in disc degeneration.
24550462 Rps23p hydroxylation can either increase or decrease translational accuracy in a stop codon context-dependent manner.
22944692 HIV-1 Rev interacting protein, ribosomal protein S23 (RPS23), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22174317 HIV-1 Rev interacting protein, ribosomal protein S23 (RPS23), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MGKCRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCV      1 - 70
RVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKER     71 - 140
PRS                                                                       141 - 143
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25893343 2015 Dysregulated COL3A1 and RPL8, RPS16, and RPS23 in Disc Degeneration Revealed by Bioinformatics Methods.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24550462 2014 Hydroxylation of the eukaryotic ribosomal decoding center affects translational accuracy.
24550447 2014 OGFOD1 catalyzes prolyl hydroxylation of RPS23 and is involved in translation control and stress granule formation.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21269460 2011 Initial characterization of the human central proteome.
More...