Property Summary

NCBI Gene PubMed Count 23
PubMed Score 90.71
PubTator Score 21.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MGKCRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCV      1 - 70
RVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKER     71 - 140
PRS                                                                       141 - 143
//

Text Mined References (30)

PMID Year Title