Property Summary

NCBI Gene PubMed Count 24
PubMed Score 56.55
PubTator Score 251.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.097 6.1e-04
astrocytic glioma 1.200 4.0e-03
Breast cancer 2.500 5.0e-02
ependymoma 1.200 2.4e-12
group 3 medulloblastoma 1.500 1.5e-04
hepatocellular carcinoma 1.300 5.3e-06
malignant mesothelioma 1.500 1.1e-04
medulloblastoma, large-cell 1.400 4.6e-04
oligodendroglioma 1.600 1.9e-03
osteosarcoma -1.274 1.8e-05
ovarian cancer 1.400 2.2e-05
pancreatic cancer 1.100 3.0e-03
pancreatic carcinoma 1.100 3.0e-03
primary pancreatic ductal adenocarcinoma 1.329 9.5e-04
primitive neuroectodermal tumor 1.100 3.0e-04
psoriasis -1.500 5.3e-05
Rheumatoid arthritis 2.300 2.2e-04
tuberculosis and treatment for 6 months -1.300 2.8e-03

Gene RIF (5)

AA Sequence

MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYP      1 - 70
TTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSS     71 - 140
IDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLE    141 - 210
HSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSC    211 - 280
HICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV            281 - 342
//

Text Mined References (27)

PMID Year Title