Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
R01 Count 2
Funding $181,960.2
PubMed Score 51.60
PubTator Score 251.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession P61962 B4E039 D3DU14 O15491 Q9DAE4
Symbols AN11
HAN11
WDR68
SWAN-1

Gene

Gene RIF (4)

PMID Text
25342745 results demonstrate that the molecular chaperone TRiC/CCT is essential for correct protein folding, DYRK1A binding, and nuclear accumulation of WDR68.
21777625 DYRK1A binds specifically to WDR68 in cells; the binding, but not the phosphorylation event, induces the nuclear translocation of WDR68.
20940704 Han11 was required to allow coupling of MEKK1 to DYRK1 and HIPK2.
16887337 that AN11 may be a physiological regulator of GLI1 transcriptional activity

AA Sequence

MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYP      1 - 70
TTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSS     71 - 140
IDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLE    141 - 210
HSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSC    211 - 280
HICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV            281 - 342
//

Text Mined References (24)

PMID Year Title
27307198 2016 The adaptor protein DCAF7 mediates the interaction of the adenovirus E1A oncoprotein with the protein kinases DYRK1A and HIPK2.
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25342745 2014 The molecular chaperone TRiC/CCT binds to the Trp-Asp 40 (WD40) repeat protein WDR68 and promotes its folding, protein kinase DYRK1A binding, and nuclear accumulation.
23864635 2013 Dissection of the C-terminal region of E1A redefines the roles of CtBP and other cellular targets in oncogenic transformation.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
21777625 2011 DYRK1A binds to an evolutionarily conserved WD40-repeat protein WDR68 and induces its nuclear translocation.
21328542 2011 ZNF703 gene amplification at 8p12 specifies luminal B breast cancer.
21269460 2011 Initial characterization of the human central proteome.
20940704 2010 The WD40-repeat protein Han11 functions as a scaffold protein to control HIPK2 and MEKK1 kinase functions.
18391951 2008 Many sequence variants affecting diversity of adult human height.
More...