Property Summary

NCBI Gene PubMed Count 23
PubMed Score 26.71
PubTator Score 12.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.771 0.001
medulloblastoma 1.100 0.013
medulloblastoma, large-cell 1.500 0.000
active Crohn's disease 1.005 0.023
progressive supranuclear palsy -1.300 0.006

Synonym

Accession P61960 Q14346 Q5VXS0 Q6IAG6 Q9CPX2 Q9NZF2
Symbols BM-002
C13orf20

Gene

PDB

1WXS   5HKH   5L95  

Gene RIF (9)

PMID Text
25219498 ASC1 is a target for ufmylation and that UFBP1 is an essential component for ASC1 ufmylation.
24966333 binding of ATP to Uba5 approximately Ufm1 thioester was required for efficient transfer of Ufm1 from Uba5 to Ufc1 via transthiolation.
24915089 results of an in vitro truncation assay suggest that Uba5 residues 57-363 comprise the minimal fragment required for the high-efficiency activation of Ufm1
24893112 transcription downregulation of the Ufm1 and FAT10 conjugation system in liver Mallory-Denk bodies formation
24726913 NCAM140 interacts with ufc1 and its trafficking and endocytosis is upregulated in the presense of Ufm1.
24603482 Thus, UfSP2 proteins have protease- and Ufm1-independent functions in GPCR biogenesis.
23152784 the Ufm1 system plays a critical role in vesicle trafficking, and its inhibition may lead to protein overload in the ER and UPR activation.
20018847 A novel type of E3 ligase for the Ufm1 conjugation system.
16527251 The solution structure and dynamics of human Ufm1 (hsUfm1) by nuclear magnetic resonance spectroscopy was analysed.

AA Sequence

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH      1 - 70
GSELRIIPRDRVGSC                                                            71 - 85
//

Text Mined References (24)

PMID Year Title
26872069 2016 UBA5 Mutations Cause a New Form of Autosomal Recessive Cerebellar Ataxia.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
24966333 2014 Mechanistic study of Uba5 enzyme and the Ufm1 conjugation pathway.
24915089 2014 Characterization, crystallization and preliminary X-ray crystallographic analysis of the Uba5 fragment necessary for high-efficiency activation of Ufm1.
24893112 2014 Ufmylation and FATylation pathways are downregulated in human alcoholic and nonalcoholic steatohepatitis, and mice fed DDC, where Mallory-Denk bodies (MDBs) form.
24726913 2014 Cytoplasmic domain of NCAM140 interacts with ubiquitin-fold modifier-conjugating enzyme-1 (Ufc1).
24603482 2014 An ER complex of ODR-4 and ODR-8/Ufm1 specific protease 2 promotes GPCR maturation by a Ufm1-independent mechanism.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23152784 2012 Transcriptional regulation of the Ufm1 conjugation system in response to disturbance of the endoplasmic reticulum homeostasis and inhibition of vesicle trafficking.
21269460 2011 Initial characterization of the human central proteome.
More...