Property Summary

NCBI Gene PubMed Count 28
PubMed Score 31.23
PubTator Score 12.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.005 2.3e-02
group 4 medulloblastoma 1.100 2.5e-03
medulloblastoma, large-cell 1.500 1.4e-04
osteosarcoma 1.771 1.5e-03
progressive supranuclear palsy -1.300 5.6e-03

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH      1 - 70
GSELRIIPRDRVGSC                                                            71 - 85
//

Text Mined References (29)

PMID Year Title