Property Summary

NCBI Gene PubMed Count 116
Grant Count 62
R01 Count 42
Funding $6,643,284.38
PubMed Score 177.18
PubTator Score 126.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.100 0.008
psoriasis -1.300 0.007
osteosarcoma -1.024 0.001

Synonym

Accession P61956 B2R4I2 P55855 Q32Q42 Q6IPZ6 Q96HK1 SUMO-2
Symbols HSMT3
SMT3B
SUMO3
Smt3A
SMT3H2

Gene

PDB

2N9E   5D2M   2D07   2IO0   2IO3   3ZO5   1Z5Q   3UIN   3UIO   1WM2   1WM3   1WZ0   2AWT   2CKH   2IYD   2N1W   2RPQ   4BKG   4NPN  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
624384 confirmatory 22 / 0 / 20 Dose response confirmation of uHTS inhibitor hits of SUMO1-mediated protein-protein interactions using a SUMO2 fluorescence resonance energy transfer selectivity assay
624385 confirmatory 31 / 0 / 11 Dose response confirmation of uHTS inhibitor hits of SUMO1-mediated protein-protein interactions using a SUMO2 fluorescence polarization selectivity assay

Gene RIF (81)

PMID Text
26719330 Data suggest that RAP80 SIM (SUMO interacting motif) binds SUMO-2; both specificity and affinity are enhanced through phosphorylation of canonical CK2 (casein kinase 2) site within the SIM.
26627832 Hsp27-Ubc9 pathway recognizes the conformation of mutant CFTR which leads to its SUMO-2 conjugation and degradation by the ubiquitin-proteasome system.
26458400 Small ubiquitin-related modifier 2/3 interacts with p65 and stabilizes it in the cytoplasm in HBV-associated hepatocellular carcinoma.
26223657 Data indicate that small ubiquitin-like modifiers SUMO1, SUMO2, or SUMO3 were found in nuclear speckles.
26223632 Adenovirus E4-ORF3 targets PIAS3 and together with E1B-55K remodels SUMO2/SUMO3 Interactions in the nucleus and at virus genome replication domains.
26200910 present a comprehensive proteomic analysis of changes in the cellular SUMO2 proteome during HSV-1 infection
26152697 Data show that substantial increases in the binding of small ubiquitin-like modifier 2 (SUMO-2) to active DNA regulatory elements in response to heat stress.
26060329 Data suggest that small ubiquitin-related modifier protein SUMO1 modification of the promyelocytic leukemia protein (PML) RING domain promotes SUMO2 conjugation to Lys160.
25884224 Kif18A is covalently modified by SUMO2 during the cell cycle, and its sumoylation peaks at metaphase and then rapidly decreases upon anaphase onset
25880753 These results confirm that the SUMO machinery is involved in TRIM5alpha-mediated retroviral restriction, and demonstrate that TRIM5alpha is a SUMO 1 and SUMO 2 substrate.
More...

AA Sequence

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINET      1 - 70
DTPAQLEMEDEDTIDVFQQQTGGVY                                                  71 - 95
//

Text Mined References (127)

PMID Year Title
26719330 2016 Molecular Basis for Phosphorylation-dependent SUMO Recognition by the DNA Repair Protein RAP80.
26627832 2016 Non-native Conformers of Cystic Fibrosis Transmembrane Conductance Regulator NBD1 Are Recognized by Hsp27 and Conjugated to SUMO-2 for Degradation.
26524494 2015 Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
26458400 2015 Small ubiquitin-related modifier 2/3 interacts with p65 and stabilizes it in the cytoplasm in HBV-associated hepatocellular carcinoma.
26223657 2015 Small Ubiquitin-like Modifier Alters IFN Response.
26223632 2015 Adenovirus E4-ORF3 Targets PIAS3 and Together with E1B-55K Remodels SUMO Interactions in the Nucleus and at Virus Genome Replication Domains.
26200910 2015 Analysis of the SUMO2 Proteome during HSV-1 Infection.
26152697 2015 Proteotoxic stress reprograms the chromatin landscape of SUMO modification.
26060329 2015 SUMO deconjugation is required for arsenic-triggered ubiquitylation of PML.
25884224 2015 Sumoylation of Kif18A plays a role in regulating mitotic progression.
More...