Property Summary

NCBI Gene PubMed Count 128
PubMed Score 136.72
PubTator Score 126.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 7.1e-04
psoriasis 6694 7.4e-03
ependymoma 4679 8.0e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.326 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.100 8.0e-03
osteosarcoma -1.024 7.1e-04
psoriasis -1.300 7.4e-03

Synonym

Accession P61956 B2R4I2 P55855 Q32Q42 Q6IPZ6 Q96HK1 SUMO-2
Symbols HSMT3
SMT3B
SUMO3
Smt3A
SMT3H2

Gene

PDB

2N9E   5D2M   2D07   2IO0   2IO3   3ZO5   1Z5Q   3UIN   3UIO   1WM2   1WM3   1WZ0   2AWT   2CKH   2IYD   2N1W   2RPQ   4BKG   4NPN   5ELU   5EQL   5GHB   5GHC  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (87)

AA Sequence

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINET      1 - 70
DTPAQLEMEDEDTIDVFQQQTGGVY                                                  71 - 95
//

Text Mined References (140)

PMID Year Title