Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession P61583
Symbols ERVK5
HERV-KII
HERV-K(II)

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MNPSEMQRKGPPQRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHRRL      1 - 70
HFVLY                                                                      71 - 75
//

Text Mined References (4)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
12060620 2002 A novel gene from the human endogenous retrovirus K expressed in transformed cells.
11401426 2001 Transcriptionally active HERV-K genes: identification, isolation, and chromosomal mapping.
7983737 1995 Human endogenous retrovirus K10: expression of Gag protein and detection of antibodies in patients with seminomas.