Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P61581
Symbols PR
c22_A
Protease
HERV-K101
Proteinase

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MNPSEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHRRL      1 - 70
HFVMC                                                                      71 - 75
//

Text Mined References (6)

PMID Year Title