Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession P61573
Symbols PR
Protease
Proteinase
polymerase

Gene

 GO Function (1)

 GO Component (2)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVT      1 - 70
QTPESMLLAALMIVSMVSAGVPNSSEETATIENGP                                        71 - 105
//

Text Mined References (6)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18664271 2008 Expression patterns of transcribed human endogenous retrovirus HERV-K(HML-2) loci in human tissues and the need for a HERV Transcriptome Project.
15063128 2004 Human endogenous retrovirus HERV-K(HML-2) proviruses with Rec protein coding capacity and transcriptional activity.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
10469592 1999 Many human endogenous retrovirus K (HERV-K) proviruses are unique to humans.
9971820 1999 Identification of an active reverse transcriptase enzyme encoded by a human endogenous HERV-K retrovirus.