Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Synonym

Accession P61572
Symbols PR
P1.8
envK3
Protease
Proteinase
polymerase
HERV-K(C19)

Gene

 GO Function (1)

 GO Component (2)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVT      1 - 70
QTPESMLLAALMIVSMVSAGVPNSSEETATIENGP                                        71 - 105
//

Text Mined References (10)

PMID Year Title