Property Summary

NCBI Gene PubMed Count 63
Grant Count 193
R01 Count 137
Funding $22,666,858.64
PubMed Score 391.42
PubTator Score 152.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
urothelial carcinoma -2.800 0.000
malignant mesothelioma 1.700 0.000
medulloblastoma, large-cell 3.100 0.000
primitive neuroectodermal tumor 3.400 0.013
lung cancer 4.600 0.000
interstitial cystitis -3.200 0.000
cystic fibrosis -1.200 0.002
ovarian cancer -2.600 0.000

Synonym

Accession P61371 P20663 P47894 Islet-1
Symbols Isl-1
ISLET1

Gene

Gene RIF (46)

PMID Text
26495868 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic beta-Cell Target Genes
26332997 Concurrent ISL1/HOXA9 methylation in HG-NMIBC reliably predicted tumour recurrence and progression within one year (Positive Predictive Value 91.7%), and was associated with disease-specific mortality
26142548 Suggest that ISL-1 may be a useful prognostic biomarker and may represent a novel therapeutic target for gastric adenocarcinoma.
25763902 The present study identified the first genome-wide significant locus for classic bladder exstrophy at chromosomal region 5q11.1, and provides strong evidence for the hypothesis that ISL1 is the responsible candidate gene in this region.
25524439 Isl1 overexpression in embryonic stem cells results in normal electrophysiologically functioning cells.
25070240 ISL-1 is tightly linked to non-Hodgkin lymphoma proliferation and development by promoting c-Myc transcription, and its aberrant expression was regulated by p-STAT3/p-c-Jun/ISL-1 complex activation.
25015099 Tcf7l2 is regulating proinsulin expression directly via Isl1, Ins1 and indirectly via MafA, NeuroD1 and Pdx1.
24845569 these results demonstrate a positive feedback regulation of ISL-1 in diffuse large B cell lymphoma but not in pancreatic beta-cells, which might result in the functional diversities of ISL-1 in different physiological and pathological processes.
24751901 ISL1 is commonly expressed in rhabdomyosarcoma, particularly the alveolar subtype
24674670 This study demonstrates that the Isl1-Gata3 transcription regulatory axis is essential for normal pyloric development.
More...

AA Sequence

MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRD      1 - 70
YIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERAS     71 - 140
LGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALM    141 - 210
KEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQAN    211 - 280
PVEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA     281 - 349
//

Text Mined References (64)

PMID Year Title
26495868 2015 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic ?-Cell Target Genes.
26332997 2015 Methylation of HOXA9 and ISL1 Predicts Patient Outcome in High-Grade Non-Invasive Bladder Cancer.
26142548 2015 An abnormally high expression of ISL-1 represents a potential prognostic factor in gastric cancer.
25763902 2015 Genome-wide association study and meta-analysis identify ISL1 as genome-wide significant susceptibility gene for bladder exstrophy.
25524439 2015 Direct nkx2-5 transcriptional repression of isl1 controls cardiomyocyte subtype identity.
25416956 2014 A proteome-scale map of the human interactome network.
25070240 2014 ISL-1 is overexpressed in non-Hodgkin lymphoma and promotes lymphoma cell proliferation by forming a p-STAT3/p-c-Jun/ISL-1 complex.
25015099 2014 TCF7L2 is a master regulator of insulin production and processing.
24845569 2014 A positive feedback regulation of ISL-1 in DLBCL but not in pancreatic ?-cells.
24751901 2014 Expression of the LIM homeobox domain transcription factor ISL1 (Islet-1) is frequent in rhabdomyosarcoma but very limited in other soft tissue sarcoma types.
More...