Property Summary

NCBI Gene PubMed Count 69
PubMed Score 410.31
PubTator Score 152.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cystic fibrosis -1.200 1.5e-03
interstitial cystitis -2.500 3.6e-03
lung cancer 2.100 4.9e-04
malignant mesothelioma 1.700 1.7e-05
medulloblastoma, large-cell 3.100 1.5e-05
ovarian cancer -2.600 4.8e-07
primitive neuroectodermal tumor 3.400 1.3e-02
urothelial carcinoma -2.800 1.2e-08

Gene RIF (51)

AA Sequence

MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRD      1 - 70
YIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERAS     71 - 140
LGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALM    141 - 210
KEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQAN    211 - 280
PVEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA     281 - 349
//

Text Mined References (70)

PMID Year Title