Property Summary

NCBI Gene PubMed Count 26
Grant Count 3
Funding $447,030
PubMed Score 44.71
PubTator Score 38.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -3.700 0.044
diabetes mellitus -1.800 0.003
ovarian cancer -1.100 0.000

Synonym

Accession P61353 P08526 Q4G0A9
Symbols L27

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (3)

PMID Text
25424902 Loss of function mutations in RPL27 and RPS27 lead to Diamond-Blackfan anaemia.
23166591 Expression of HIV-1 Tat upregulates the abundance of ribosomal protein L27 (RPL27) in the nucleoli of Jurkat T-cells
22174317 Expression of HIV-1 Tat upregulates the abundance of ribosomal protein L27 (RPL27) in the nucleoli of Jurkat T-cells

AA Sequence

MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKS      1 - 70
FVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKNKWFFQKLRF         71 - 136
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25424902 2015 Loss of function mutations in RPL27 and RPS27 identified by whole-exome sequencing in Diamond-Blackfan anaemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...