Property Summary

NCBI Gene PubMed Count 28
PubMed Score 47.03
PubTator Score 38.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
DIAMOND-BLACKFAN ANEMIA 16 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 8.7e-05
diabetes mellitus 1728 6.4e-03
lung cancer 4740 4.4e-02
Disease Target Count Z-score Confidence
Diamond-Blackfan anemia 31 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.100 6.4e-03
lung cancer -3.700 4.4e-02
ovarian cancer -1.100 8.7e-05

Gene RIF (3)

AA Sequence

MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKS      1 - 70
FVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKNKWFFQKLRF         71 - 136
//

Text Mined References (36)

PMID Year Title