Property Summary

NCBI Gene PubMed Count 29
PubMed Score 26.64
PubTator Score 9.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 1.11504799668989E-15
atypical teratoid / rhabdoid tumor 4369 9.10356864722705E-9
inflammatory breast cancer 404 2.73290386787808E-6
ovarian cancer 8492 1.0887034542275E-5
glioblastoma 5572 2.07567429946185E-5
Multiple myeloma 1328 2.10221319637084E-5
adult high grade glioma 2148 9.41445976108794E-5
osteosarcoma 7933 1.01067177686028E-4
cystic fibrosis 1670 2.57338551748062E-4
medulloblastoma 1524 5.22138383151118E-4
Waldenstrons macroglobulinemia 765 9.21457852336039E-4
medulloblastoma, large-cell 6234 0.00166310481066891
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0124085702203127
ependymoma 2514 0.0204204994966073
subependymal giant cell astrocytoma 2287 0.0344801889666918

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.576 0.001
Multiple myeloma 1.935 0.000
ependymoma -1.200 0.020
osteosarcoma -1.337 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma -1.200 0.001
medulloblastoma, large-cell -1.100 0.002
intraductal papillary-mucinous neoplasm ... -1.200 0.012
cystic fibrosis -1.300 0.000
adult high grade glioma -1.600 0.000
subependymal giant cell astrocytoma -1.350 0.034
lung adenocarcinoma -1.100 0.000
inflammatory breast cancer -1.700 0.000
ovarian cancer -2.000 0.000

Synonym

Accession P61313 P39030 P41051 Q5U0C0 Q642I1 Q6IPX6 Q8WYP2 Q96C44 Q9H2E5
Symbols L15
EC45
DBA12
RPL10
RPLY10
RPYL10

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
26498693 Downregulation of RPL15 is associated with tumor progression in pancreatic ductal adenocarcinoma.
23812780 These data identify RPL15 as a new gene involved in Diamond-Blackfan anemia.
21612406 ISG56 interacts with ribosomal protein L15 in gastric cancer cells.
21509594 RPL15 gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
19834535 Observational study of gene-disease association. (HuGE Navigator)
16608517 RPL15 promotes cell proliferation in gastric neoplasms

AA Sequence

MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGG      1 - 70
RKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHK     71 - 140
AIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRRNTLQLHRYR          141 - 204
//

Text Mined References (38)

PMID Year Title
26498693 2015 Downregulation of RPL15 may predict poor survival and associate with tumor progression in pancreatic ductal adenocarcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23812780 2013 Novel deletion of RPL15 identified by array-comparative genomic hybridization in Diamond-Blackfan anemia.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...