Property Summary

NCBI Gene PubMed Count 23
Grant Count 13
R01 Count 13
Funding $470,396.81
PubMed Score 42.71
PubTator Score 71.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26687066 Six1 regulates p53 via a dual mechanism involving upregulation of microRNA-27a and downregulation of RPL26.
25723396 HIV-1 NC co-localizes with ribosomal protein RPL26 in the cytoplasm
22868929 The results showed that knockdown of RPL26 or RPL29 expression significantly suppressed cell proliferation, induced cell arrest at G0/G1 phase and enhanced cell apoptosis
22433872 suggest a model in which the base pairings in the p53 UTR interaction regions are critical for both translational repression and stress induction of p53 by NCL and RPL26
22431104 Northern Blot Together with RPL5, RPL11, and RPS7, RPL26 is the fourth RP regulating p53 activity that is linked to diamond-blackfan anemia.
18951086 Mdm2 binds L26 and drives its polyubiquitylation and proteasomal degradation.

AA Sequence

MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKV      1 - 70
VQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETI     71 - 140
EKMQE                                                                     141 - 145
//

Text Mined References (29)

PMID Year Title
26687066 2015 The Six1 oncoprotein downregulates p53 via concomitant regulation of RPL26 and microRNA-27a-3p.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22868929 2012 Silencing expression of ribosomal protein L26 and L29 by RNA interfering inhibits proliferation of human pancreatic cancer PANC-1 cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22433872 2012 Interactions of nucleolin and ribosomal protein L26 (RPL26) in translational control of human p53 mRNA.
22431104 2012 Frameshift mutation in p53 regulator RPL26 is associated with multiple physical abnormalities and a specific pre-ribosomal RNA processing defect in diamond-blackfan anemia.
More...