Property Summary

NCBI Gene PubMed Count 27
PubMed Score 44.76
PubTator Score 71.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKV      1 - 70
VQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETI     71 - 140
EKMQE                                                                     141 - 145
//

Text Mined References (35)

PMID Year Title